StarFunc result for job id O60927

User Input

>input (126 residues)
MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKC
CCIYEKPRAFGESSTESDEEEEEGCGHTHCVRGHRKGRRRATLGPTPTTPPQPPDPSQPP
PGPMQH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Click to view	Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
	1	AFDB:O60927	0.999	0.999	7.078E-19	126	1.000	1.000	O60927.pdb.gz	PP1RB_HUMAN E3 ubiquitin-protein ligase PPP1R11 OS=Homo sapiens OX=9606 GN=PPP1R11 PE=1 SV=1
	2	AFDB:Q8K1L5	0.389	0.379	4.435E-14	131	0.889	0.855	Q8K1L5.pdb.gz	PP1RB_MOUSE E3 ubiquitin-protein ligase PPP1R11 OS=Mus musculus OX=10090 GN=Ppp1r11 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60927	1.09e-88	254	126	1.000	1.000	PP1RB_HUMAN E3 ubiquitin-protein ligase PPP1R11 OS=Homo sapiens OX=9606 GN=PPP1R11 PE=1 SV=1
2	Q6MFY6	7.75e-46	146	127	0.960	0.953	PP1RB_RAT E3 ubiquitin-protein ligase PPP1R11 OS=Rattus norvegicus OX=10116 GN=Ppp1r11 PE=2 SV=2
3	Q8K1L5	1.05e-40	133	131	0.881	0.847	PP1RB_MOUSE E3 ubiquitin-protein ligase PPP1R11 OS=Mus musculus OX=10090 GN=Ppp1r11 PE=1 SV=1
4	Q9VMI2	4.37e-17	74.3	163	0.381	0.294	Q9VMI2_DROME GEO08832p1 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG13994 PE=2 SV=1
5	Q7JYN8	4.67e-17	74.3	164	0.381	0.293	Q7JYN8_DROME AT31406p (Fragment) OS=Drosophila melanogaster OX=7227 GN=CG13994 PE=2 SV=1
6	Q9VRC5	2.58e-14	68.2	215	0.286	0.167	Q9VRC5_DROME AT30947p OS=Drosophila melanogaster OX=7227 GN=I-3 PE=2 SV=4
7	Q8IJ88	6.24e-11	57.4	116	0.183	0.198	Q8IJ88_PLAF7 Protein phosphatase inhibitor 3 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1031700 PE=4 SV=2
8	O14218	2.99e-09	52.8	104	0.159	0.192	YPI1_SCHPO Type 1 phosphatases regulator ypi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ypi1 PE=3 SV=1
9	Q8S8F7	3.23e-09	52.8	107	0.206	0.243	INH3_ARATH Protein phosphatase 1 regulatory subunit INH3 OS=Arabidopsis thaliana OX=3702 GN=INH3 PE=1 SV=1
10	Q59ZW4	1.33e-04	40.8	124	0.143	0.145	YPI1_CANAL Type 1 phosphatases regulator YPI1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=YPI1 PE=3 SV=1
11	P43587	0.012	35.8	155	0.127	0.103	YPI1_YEAST Type 1 phosphatases regulator YPI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YPI1 PE=1 SV=1
12	O86313	1.4	30.4	411	0.103	0.032	O86313_MYCTU Possible membrane protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1230c PE=4 SV=1
13	Q6IVU5	1.7	29.3	94	0.167	0.223	Z_JUNIN RING finger protein Z OS=Junin mammarenavirus OX=2169991 GN=Z PE=1 SV=1
14	Q9CXJ1	1.7	30.4	523	0.095	0.023	SYEM_MOUSE Probable glutamate--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Ears2 PE=1 SV=1
15	Q8L7A9	3.3	29.6	938	0.135	0.018	AP4E_ARATH AP-4 complex subunit epsilon OS=Arabidopsis thaliana OX=3702 GN=At1g31730 PE=1 SV=1
16	Q38CT5	3.4	29.3	473	0.087	0.023	Q38CT5_TRYB2 Variant surface glycoprotein (VSG, atypical), putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.244.2200 PE=4 SV=1
17	Q38CT8	3.4	29.3	474	0.087	0.023	Q38CT8_TRYB2 Variant surface glycoprotein (VSG, atypical), putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.244.2240 PE=4 SV=1
18	Q96N19	5.0	28.9	417	0.127	0.038	G137A_HUMAN Integral membrane protein GPR137 OS=Homo sapiens OX=9606 GN=GPR137 PE=2 SV=2
19	Q9LS46	6.5	28.5	598	0.071	0.015	ALMT9_ARATH Aluminum-activated malate transporter 9 OS=Arabidopsis thaliana OX=3702 GN=ALMT9 PE=2 SV=1
20	Q3EAE5	6.6	28.5	441	0.175	0.050	FDL24_ARATH Putative F-box/FBD/LRR-repeat protein At4g00315 OS=Arabidopsis thaliana OX=3702 GN=At4g00315 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07491 PPI_Ypi1	5.9e-18	75.8	Protein phosphatase inhibitor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000005977

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000016743	0.963	Protein phosphatase 1, regulatory subunit 7
2	61853.ENSNLEP00000021041	0.930	Protein phosphatase 6, catalytic subunit
3	61853.ENSNLEP00000018622	0.918	Protein phosphatase 1, catalytic subunit, beta isozyme
4	61853.ENSNLEP00000003868	0.897	Protein phosphatase 1, catalytic subunit, gamma isozyme
5	61853.ENSNLEP00000007753	0.897	Protein phosphatase 1, catalytic subunit, alpha isozyme
6	61853.ENSNLEP00000010191	0.877	Protein phosphatase 1, regulatory (inhibitor) subunit 2
7	61853.ENSNLEP00000014569	0.826	Protein phosphatase 2, catalytic subunit, beta isozyme
8	61853.ENSNLEP00000009847	0.813	Protein phosphatase 2, catalytic subunit, alpha isozyme
9	61853.ENSNLEP00000007547	0.693	UTP20, small subunit (SSU) processome component, homolog (yeast)
10	61853.ENSNLEP00000011379	0.692	NSFL1 (p97) cofactor (p47)
11	61853.ENSNLEP00000006599	0.691	UTP4, small subunit processome component
12	61853.ENSNLEP00000012918	0.691	Natural cytotoxicity triggering receptor 1
13	61853.ENSNLEP00000011790	0.690	Protein phosphatase 1, regulatory subunit 8
14	61853.ENSNLEP00000003365	0.682	HIV-1 Tat specific factor 1
15	61853.ENSNLEP00000020260	0.677	Protein phosphatase 3, catalytic subunit, beta isozyme
16	61853.ENSNLEP00000002579	0.657	Protein phosphatase 4, catalytic subunit
17	61853.ENSNLEP00000007059	0.645	POU domain protein
18	61853.ENSNLEP00000006177	0.641	Guanine nucleotide binding protein-like 1
19	61853.ENSNLEP00000009794	0.640	Protein phosphatase, EF-hand calcium binding domain 2
20	61853.ENSNLEP00000011832	0.640	Protein phosphatase, EF-hand calcium binding domain 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140678	1.000	molecular function inhibitor activity
GO:0005515	1.000	protein binding
GO:0019888	0.998	protein phosphatase regulator activity
GO:0004842	0.998	ubiquitin-protein transferase activity
GO:0061659	0.996	ubiquitin-like protein ligase activity
GO:0004857	0.993	enzyme inhibitor activity
GO:0061630	0.991	ubiquitin protein ligase activity
GO:0004864	0.896	protein phosphatase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008152	0.996	metabolic process
GO:0009987	0.991	cellular process
GO:0071704	0.982	organic substance metabolic process
GO:0044237	0.980	cellular metabolic process
GO:0044238	0.975	primary metabolic process
GO:0006807	0.960	nitrogen compound metabolic process
GO:0019538	0.946	protein metabolic process
GO:0044260	0.843	cellular macromolecule metabolic process
GO:0006511	0.816	ubiquitin-dependent protein catabolic process
GO:0065007	0.777	biological regulation
GO:0050789	0.728	regulation of biological process
GO:0050794	0.531	regulation of cellular process
GO:0019222	0.504	regulation of metabolic process
GO:0060255	0.490	regulation of macromolecule metabolic process
GO:0050896	0.412	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	0.942	intracellular organelle
GO:0043227	0.938	membrane-bounded organelle
GO:0043231	0.931	intracellular membrane-bounded organelle
GO:0005634	0.736	nucleus
GO:0070013	0.480	intracellular organelle lumen
GO:0031981	0.358	nuclear lumen
GO:0005654	0.315	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]