StarFunc result for job id O60934

User Input

>input (754 residues)
MWKLLPAAGPAGGEPYRLLTGVEYVVGRKNCAILIENDQSISRNHAVLTANFSVTNLSQT
DEIPVLTLKDNSKYGTFVNEEKMQNGFSRTLKSGDGITFGVFGSKFRIEYEPLVACSSCL
DVSGKTALNQAILQLGGFTVNNWTEECTHLVMVSVKVTIKTICALICGRPIVKPEYFTEF
LKAVESKKQPPQIESFYPPLDEPSIGSKNVDLSGRQERKQIFKGKTFIFLNAKQHKKLSS
AVVFGGGEARLITEENEEEHNFFLAPGTCVVDTGITNSQTLIPDCQKKWIQSIMDMLQRQ
GLRPIPEAEIGLAVIFMTTKNYCDPQGHPSTGLKTTTPGPSLSQGVSVDEKLMPSAPVNT
TTYVADTESEQADTWDLSERPKEIKVSKMEQKFRMLSQDAPTVKESCKTSSNNNSMVSNT
LAKMRIPNYQLSPTKLPSINKSKDRASQQQQTNSIRNYFQPSTKKRERDEENQEMSSCKS
ARIETSCSLLEQTQPATPSLWKNKEQHLSENEPVDTNSDNNLFTDTDLKSIVKNSASKSH
AAEKLRSNKKREMDDVAIEDEVLEQLFKDTKPELEIDVKVQKQEEDVNVRKRPRMDIETN
DTFSDEAVPESSKISQENEIGKKRELKEDSLWSAKEISNNDKLQDDSEMLPKKLLLTEFR
SLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELE
EWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60934	1.000	1.000	0.000	754	1.000	1.000	O60934.pdb.gz	NBN_HUMAN Nibrin OS=Homo sapiens OX=9606 GN=NBN PE=1 SV=1
2	AFDB:Q9JIL9	0.663	0.665	6.203E-95	750	0.698	0.701	Q9JIL9.pdb.gz	NBN_RAT Nibrin OS=Rattus norvegicus OX=10116 GN=Nbn PE=1 SV=2
3	AFDB:Q9R207	0.536	0.538	1.691E-92	751	0.702	0.704	Q9R207.pdb.gz	NBN_MOUSE Nibrin OS=Mus musculus OX=10090 GN=Nbn PE=1 SV=1
4	AFDB:Q9DE07	0.440	0.441	9.576E-69	753	0.496	0.497	Q9DE07.pdb.gz	NBN_CHICK Nibrin OS=Gallus gallus OX=9031 GN=NBN PE=1 SV=1
5	AFDB:Q9VT40	0.369	0.342	2.929E-33	818	0.206	0.189	Q9VT40.pdb.gz	Q9VT40_DROME Nibrin OS=Drosophila melanogaster OX=7227 GN=nbs PE=1 SV=4
6	PDB:7dvqX	0.120	0.524	3.776E-7	156	0.037	0.179	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
7	PDB:2ff4A	0.111	0.216	3.967E-6	379	0.033	0.066	2ff4A.pdb.gz	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
8	PDB:5gm6U	0.120	0.463	4.426E-5	176	0.033	0.142	5gm6U.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
9	PDB:6l9wD	0.112	0.501	2.123E-4	142	0.025	0.134	6l9wD.pdb.gz
10	PDB:2kb3A	0.117	0.552	2.702E-4	143	0.034	0.182	2kb3A.pdb.gz
11	PDB:7lsyY	0.099	0.089	3.652E-4	855	0.073	0.064	7lsyY.pdb.gz	Structural basis of long-range to short-range synaptic transition in NHEJ.
12	PDB:5z56X	0.104	0.415	1.649E-3	159	0.025	0.119	5z56X.pdb.gz	Structure of the human activated spliceosome in three conformational states.
13	AFDB:B7SY83	0.104	0.057	7.007E-3	1477	0.139	0.071	B7SY83.pdb.gz	PS1_ARATH FHA domain-containing protein PS1 OS=Arabidopsis thaliana OX=3702 GN=PS1 PE=2 SV=1
14	AFDB:Q5PSV9	0.119	0.055	1.006E-2	1707	0.125	0.055	Q5PSV9.pdb.gz	MDC1_MOUSE Mediator of DNA damage checkpoint protein 1 OS=Mus musculus OX=10090 GN=Mdc1 PE=1 SV=1
15	AFDB:Q7TT79	0.106	0.098	1.006E-2	822	0.135	0.124	Q7TT79.pdb.gz	MCPH1_MOUSE Microcephalin OS=Mus musculus OX=10090 GN=Mcph1 PE=1 SV=1
16	PDB:7p5zG	0.088	0.287	1.954E-2	213	0.017	0.061	7p5zG.pdb.gz	Structural mechanism for the selective phosphorylation of DNA-loaded MCM double hexamers by the Dbf4-dependent kinase.
17	PDB:1c9yA	0.072	0.146	2.076E-2	321	0.033	0.078	1c9yA.pdb.gz	Crystal structure of human ornithine transcarbamylase complexed with carbamoyl phosphate and L-norvaline at 1.9 A resolution.
18	PDB:2fssA	0.059	0.100	3.794E-2	353	0.023	0.048	2fssA.pdb.gz
19	AFDB:O96685	0.112	0.068	6.929E-2	1261	0.138	0.082	O96685.pdb.gz	O96685_DROME Mutator 2 OS=Drosophila melanogaster OX=7227 GN=mu2 PE=1 SV=1
20	AFDB:Q8NEM0	0.109	0.099	1.266E-1	835	0.110	0.099	Q8NEM0.pdb.gz	MCPH1_HUMAN Microcephalin OS=Homo sapiens OX=9606 GN=MCPH1 PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60934	0.0	1564	754	1.000	1.000	NBN_HUMAN Nibrin OS=Homo sapiens OX=9606 GN=NBN PE=1 SV=1
2	Q9DE07	0.0	657	753	0.513	0.514	NBN_CHICK Nibrin OS=Gallus gallus OX=9031 GN=NBN PE=1 SV=1
3	Q9JIL9	0.0	1047	750	0.699	0.703	NBN_RAT Nibrin OS=Rattus norvegicus OX=10116 GN=Nbn PE=1 SV=2
4	Q9R207	0.0	1057	751	0.707	0.710	NBN_MOUSE Nibrin OS=Mus musculus OX=10090 GN=Nbn PE=1 SV=1
5	M9NF67	8.55e-36	147	816	0.160	0.148	M9NF67_DROME Nibrin OS=Drosophila melanogaster OX=7227 GN=nbs PE=1 SV=1
6	Q9VT40	3.77e-34	142	818	0.160	0.148	Q9VT40_DROME Nibrin OS=Drosophila melanogaster OX=7227 GN=nbs PE=1 SV=4
7	Q7XD82	1.18e-15	83.2	560	0.076	0.102	NBS1_ORYSJ Nibrin homolog OS=Oryza sativa subsp. japonica OX=39947 GN=NBS1 PE=1 SV=1
8	Q0H8D7	6.23e-14	77.4	542	0.068	0.094	NBS1_ARATH Nibrin homolog OS=Arabidopsis thaliana OX=3702 GN=NBS1 PE=1 SV=1
9	Q57X11	5.56e-09	62.0	918	0.062	0.051	Q57X11_TRYB2 Recombination initiation protein NBS1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26E13.400 PE=4 SV=1
10	Q8IEN7	0.002	44.3	561	0.044	0.059	Q8IEN7_PLAF7 FHA domain-containing protein, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1307800 PE=4 SV=1
11	Q5SW79	0.015	41.2	1584	0.078	0.037	CE170_HUMAN Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1
12	A0A1U9XBC1	0.10	38.9	2089	0.031	0.011	A0A1U9XBC1_HUMAN Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 PE=4 SV=1
13	Q14676	0.10	38.9	2089	0.031	0.011	MDC1_HUMAN Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3
14	Q96EP1	0.13	38.1	664	0.034	0.039	CHFR_HUMAN E3 ubiquitin-protein ligase CHFR OS=Homo sapiens OX=9606 GN=CHFR PE=1 SV=2
15	Q9U1Y5	0.14	37.7	476	0.027	0.042	CHK2_CAEEL Serine/threonine-protein kinase chk-2 OS=Caenorhabditis elegans OX=6239 GN=chk-2 PE=2 SV=2
16	Q5PSV9	0.18	37.7	1707	0.032	0.014	MDC1_MOUSE Mediator of DNA damage checkpoint protein 1 OS=Mus musculus OX=10090 GN=Mdc1 PE=1 SV=1
17	Q54BF0	0.19	37.7	593	0.032	0.040	FHKA_DICDI Probable serine/threonine-protein kinase fhkA OS=Dictyostelium discoideum OX=44689 GN=fhkA PE=3 SV=1
18	Q6A065	0.19	37.7	1588	0.040	0.019	CE170_MOUSE Centrosomal protein of 170 kDa OS=Mus musculus OX=10090 GN=Cep170 PE=1 SV=2
19	Q810L3	0.32	37.0	664	0.041	0.047	CHFR_MOUSE E3 ubiquitin-protein ligase CHFR OS=Mus musculus OX=10090 GN=Chfr PE=1 SV=1
20	Q20129	0.35	37.0	1182	0.021	0.014	Q20129_CAEEL BRCT domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mus-101 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00533 BRCT	2.8	19.7	BRCA1 C Terminus (BRCT) domain
2	PF00498 FHA	4.8e-11	54.2	FHA domain
3	PF08599 Nbs1_C	2.5e-30	115.7	DNA damage repair protein Nbs1
4	PF16508 NIBRIN_BRCT_II	2.9e-24	97.2	Second BRCT domain on Nijmegen syndrome breakage protein
5	PF12738 PTCB-BRCT	33	15.9	twin BRCT domain
6	PF16770 RTT107_BRCT_5	0.032	25.4	Regulator of Ty1 transposition protein 107 BRCT domain
7	PF16697 Yop-YscD_cpl	0.11	24.1	Inner membrane component of T3SS, cytoplasmic domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265433

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000278616	0.999	Serine-protein kinase ATM
2	9606.ENSP00000325863	0.999	Double-strand break repair protein MRE11
3	9606.ENSP00000365588	0.999	Mediator of DNA damage checkpoint protein 1
4	9606.ENSP00000368100	0.999	DNA repair protein RAD50
5	9606.ENSP00000418960	0.999	Breast cancer type 1 susceptibility protein
6	9606.ENSP00000254942	0.997	Telomeric repeat-binding factor 2
7	9606.ENSP00000382628	0.997	DNA endonuclease RBBP8
8	9606.ENSP00000434024	0.997	Histone H2AX
9	9606.ENSP00000343741	0.993	Serine/threonine-protein kinase ATR
10	9606.ENSP00000372023	0.988	Serine/threonine-protein kinase Chk2
11	9606.ENSP00000287647	0.985	Fanconi anemia group D2 protein
12	9606.ENSP00000371475	0.985	TP53-binding protein 1
13	9606.ENSP00000300086	0.983	Telomeric repeat-binding factor 2-interacting protein 1
14	9606.ENSP00000362578	0.982	E3 ubiquitin-protein ligase RNF8
15	9606.ENSP00000426191	0.978	Cell cycle checkpoint protein RAD17
16	9606.ENSP00000260810	0.977	DNA topoisomerase 2-binding protein 1
17	9606.ENSP00000055077	0.967	Replication factor C subunit 2
18	9606.ENSP00000260947	0.967	BRCA1-associated RING domain protein 1
19	9606.ENSP00000376272	0.965	Replication factor C subunit 4
20	9606.ENSP00000421491	0.965	DNA repair protein XRCC4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003684	1.000	damaged DNA binding
GO:0140297	0.999	DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.989	response to stimulus
GO:0050789	0.988	regulation of biological process
GO:0071704	0.987	organic substance metabolic process
GO:0044237	0.987	cellular metabolic process
GO:0044238	0.986	primary metabolic process
GO:0050794	0.983	regulation of cellular process
GO:0006974	0.981	cellular response to DNA damage stimulus
GO:0044260	0.979	cellular macromolecule metabolic process
GO:0006139	0.978	nucleobase-containing compound metabolic process
GO:1901990	0.969	regulation of mitotic cell cycle phase transition
GO:0000077	0.969	DNA damage checkpoint signaling
GO:0016043	0.966	cellular component organization
GO:0048518	0.965	positive regulation of biological process
GO:0044773	0.961	mitotic DNA damage checkpoint signaling
GO:0006996	0.960	organelle organization
GO:0010972	0.958	negative regulation of G2/M transition of mitotic cell cycle
GO:0051052	0.950	regulation of DNA metabolic process
GO:0006302	0.949	double-strand break repair
GO:0051276	0.944	chromosome organization
GO:0048522	0.937	positive regulation of cellular process
GO:0051054	0.920	positive regulation of DNA metabolic process
GO:0051128	0.904	regulation of cellular component organization
GO:0044818	0.896	mitotic G2/M transition checkpoint
GO:0032200	0.894	telomere organization
GO:0065009	0.891	regulation of molecular function
GO:0007095	0.885	mitotic G2 DNA damage checkpoint signaling
GO:0045934	0.840	negative regulation of nucleobase-containing compound metabolic process
GO:0033043	0.831	regulation of organelle organization
GO:0033044	0.809	regulation of chromosome organization
GO:0051246	0.729	regulation of protein metabolic process
GO:0000723	0.697	telomere maintenance
GO:0051174	0.651	regulation of phosphorus metabolic process
GO:0019220	0.640	regulation of phosphate metabolic process
GO:0031399	0.590	regulation of protein modification process
GO:0042325	0.586	regulation of phosphorylation
GO:0010605	0.498	negative regulation of macromolecule metabolic process
GO:0050790	0.489	regulation of catalytic activity
GO:0043085	0.425	positive regulation of catalytic activity
GO:2001252	0.403	positive regulation of chromosome organization
GO:0001932	0.396	regulation of protein phosphorylation
GO:0051338	0.385	regulation of transferase activity
GO:0051247	0.378	positive regulation of protein metabolic process
GO:0032204	0.378	regulation of telomere maintenance
GO:0031401	0.345	positive regulation of protein modification process
GO:0006310	0.337	DNA recombination
GO:0071103	0.315	DNA conformation change
GO:0072331	0.306	signal transduction by p53 class mediator
GO:0022616	0.302	DNA strand elongation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000781	0.999	chromosome, telomeric region
GO:0016605	0.999	PML body
GO:0005829	0.986	cytosol
GO:0032991	0.981	protein-containing complex
GO:0140513	0.869	nuclear protein-containing complex
GO:0005730	0.653	nucleolus
GO:0090734	0.629	site of DNA damage
GO:0035861	0.624	site of double-strand break
GO:0030870	0.489	Mre11 complex
GO:0016234	0.415	inclusion body
GO:0042405	0.403	nuclear inclusion body
GO:0070533	0.396	BRCA1-C complex
GO:0005657	0.347	replication fork

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]