StarFunc result for job id O60936

User Input

>input (208 residues)
MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRR
LLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGS
GTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAE
AEPEPELEPEPDPEPEPDFEERDESEDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60936	1.000	1.000	3.721E-28	208	1.000	1.000	O60936.pdb.gz	NOL3_HUMAN Nucleolar protein 3 OS=Homo sapiens OX=9606 GN=NOL3 PE=1 SV=2
2	AFDB:Q62881	0.452	0.431	8.747E-21	221	0.846	0.796	Q62881.pdb.gz	NOL3_RAT Nucleolar protein 3 OS=Rattus norvegicus OX=10116 GN=Nol3 PE=1 SV=1
3	AFDB:Q9BX69	0.395	0.082	9.573E-6	1037	0.279	0.056	Q9BX69.pdb.gz	CARD6_HUMAN Caspase recruitment domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CARD6 PE=1 SV=2
4	AFDB:P42573	0.326	0.144	1.056E-2	503	0.154	0.064	P42573.pdb.gz	CED3_CAEEL Cell death protein 3 OS=Caenorhabditis elegans OX=6239 GN=ced-3 PE=1 SV=2
5	AFDB:A0A0C5AQN2	0.320	0.321	1.975E-2	207	0.197	0.198	A0A0C5AQN2.pdb.gz	A0A0C5AQN2_ONCMY BCL10 protein OS=Oncorhynchus mykiss OX=8022 GN=BCL10 PE=2 SV=1
6	PDB:6mksA	0.328	0.731	2.010E-2	90	0.058	0.133	6mksA.pdb.gz
7	AFDB:A0A0G2K3V0	0.327	0.299	3.298E-2	229	0.192	0.175	A0A0G2K3V0.pdb.gz	A0A0G2K3V0_RAT Caspase 9 OS=Rattus norvegicus OX=10116 GN=Casp9 PE=1 SV=2
8	AFDB:O95999	0.272	0.244	3.491E-2	233	0.159	0.142	O95999.pdb.gz	BCL10_HUMAN B-cell lymphoma/leukemia 10 OS=Homo sapiens OX=9606 GN=BCL10 PE=1 SV=1
9	AFDB:E7EC82	0.321	0.276	7.750E-2	244	0.154	0.131	E7EC82.pdb.gz	E7EC82_CHICK B-cell lymophoma 10 protein OS=Gallus gallus OX=9031 PE=2 SV=1
10	PDB:1dgnA	0.319	0.692	1.175E-1	89	0.082	0.191	1dgnA.pdb.gz
11	AFDB:D7F7W8	0.322	0.073	1.821E-1	1002	0.168	0.035	D7F7W8.pdb.gz	D7F7W8_ONCMY RNA helicase OS=Oncorhynchus mykiss OX=8022 GN=mda5 PE=2 SV=1
12	AFDB:Q96LW7	0.365	0.335	2.160E-1	228	0.130	0.118	Q96LW7.pdb.gz	CAR19_HUMAN Caspase recruitment domain-containing protein 19 OS=Homo sapiens OX=9606 GN=CARD19 PE=1 SV=1
13	PDB:4ikmA	0.332	0.154	2.464E-1	463	0.087	0.039	4ikmA.pdb.gz	The structure of the CARD8 caspase-recruitment domain suggests its association with the FIIND domain and procaspases through adjacent surfaces.
14	PDB:4irlB	0.333	0.155	2.464E-1	463	0.072	0.032	4irlB.pdb.gz	Structure of the caspase-recruitment domain from a zebrafish guanylate-binding protein.
15	PDB:2kn6A	0.235	0.250	2.761E-1	195	0.096	0.103	2kn6A.pdb.gz
16	PDB:5juyB	0.334	0.061	6.868E-1	1234	0.072	0.012	5juyB.pdb.gz	A near atomic structure of the active human apoptosome.
17	PDB:6ki0A	0.312	0.146	1.809	459	0.096	0.044	6ki0A.pdb.gz	Homotypic CARD-CARD interaction is critical for the activation of NLRP1 inflammasome.
18	PDB:7sc9AR	0.150	0.185	2.271	160	0.067	0.087	7sc9AR.pdb.gz	Structures of a phycobilisome in light-harvesting and photoprotected states.
19	PDB:7mq8LP	0.132	0.064	3.384	567	0.053	0.019	7mq8LP.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:6h6cA	0.159	0.199	4.250	151	0.077	0.106	6h6cA.pdb.gz	Proximal and distal control for ligand binding in neuroglobin: role of the CD loop and evidence for His64 gating.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60936	8.81e-142	395	208	1.000	1.000	NOL3_HUMAN Nucleolar protein 3 OS=Homo sapiens OX=9606 GN=NOL3 PE=1 SV=2
2	Q62881	1.08e-82	246	221	0.639	0.602	NOL3_RAT Nucleolar protein 3 OS=Rattus norvegicus OX=10116 GN=Nol3 PE=1 SV=1
3	Q9D1X0	2.14e-81	243	220	0.625	0.591	NOL3_MOUSE Nucleolar protein 3 OS=Mus musculus OX=10090 GN=Nol3 PE=1 SV=1
4	Q9BX69	1.77e-16	79.3	1037	0.178	0.036	CARD6_HUMAN Caspase recruitment domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CARD6 PE=1 SV=2
5	Q96RN1	1.50e-04	44.3	970	0.087	0.019	S26A8_HUMAN Testis anion transporter 1 OS=Homo sapiens OX=9606 GN=SLC26A8 PE=1 SV=1
6	O97267	7.87e-04	42.4	2114	0.087	0.009	O97267_PLAF7 Circumsporozoite- and TRAP-related protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0315200 PE=4 SV=1
7	Q8IEU9	0.001	41.6	3346	0.096	0.006	Q8IEU9_PLAF7 Erythrocyte membrane protein 1, PfEMP1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1300300 PE=4 SV=1
8	Q99109	0.005	39.7	652	0.067	0.021	REP1_USTMA Repellent protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=REP1 PE=1 SV=1
9	Q9P225	0.005	40.0	4427	0.111	0.005	DYH2_HUMAN Dynein axonemal heavy chain 2 OS=Homo sapiens OX=9606 GN=DNAH2 PE=1 SV=3
10	Q94AT1	0.021	37.7	420	0.120	0.060	P2C76_ARATH Probable protein phosphatase 2C 76 OS=Arabidopsis thaliana OX=3702 GN=At5g53140 PE=2 SV=1
11	Q8TDT2	0.045	36.6	470	0.087	0.038	GP152_HUMAN Probable G-protein coupled receptor 152 OS=Homo sapiens OX=9606 GN=GPR152 PE=1 SV=1
12	Q8BHB0	0.065	36.2	953	0.111	0.024	NOD1_MOUSE Nucleotide-binding oligomerization domain-containing protein 1 OS=Mus musculus OX=10090 GN=Nod1 PE=1 SV=1
13	D4ADT7	0.067	36.2	953	0.111	0.024	D4ADT7_RAT Nucleotide-binding oligomerization domain containing 1 OS=Rattus norvegicus OX=10116 GN=Nod1 PE=3 SV=1
14	Q9HC29	0.097	35.8	1040	0.144	0.029	NOD2_HUMAN Nucleotide-binding oligomerization domain-containing protein 2 OS=Homo sapiens OX=9606 GN=NOD2 PE=1 SV=1
15	Q9L7Q2	0.30	34.3	1906	0.115	0.013	ZMPB_STRPN Zinc metalloprotease ZmpB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=zmpB PE=3 SV=2
16	A7BJ65	0.69	33.1	937	0.115	0.026	A7BJ65_BOMMO BmRelish1 OS=Bombyx mori OX=7091 GN=100124425 PE=2 SV=1
17	Q5KSL6	0.70	33.1	1271	0.111	0.018	DGKK_HUMAN Diacylglycerol kinase kappa OS=Homo sapiens OX=9606 GN=DGKK PE=1 SV=1
18	C9E3B4	1.1	32.7	1566	0.130	0.017	C9E3B4_STRMG Surface protein adhesin OS=Streptococcus mutans OX=1309 GN=spaP PE=1 SV=1
19	Q9S9P0	1.7	32.0	990	0.111	0.023	PDS5E_ARATH Sister chromatid cohesion protein PDS5 homolog E OS=Arabidopsis thaliana OX=3702 GN=PDS5E PE=2 SV=1
20	Q9Y239	2.1	31.6	953	0.111	0.024	NOD1_HUMAN Nucleotide-binding oligomerization domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NOD1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00619 CARD	8.3e-15	65.9	Caspase recruitment domain
2	PF05887 Trypan_PARP	75	14.7	Procyclic acidic repetitive protein (PARP)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000457243

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351273	0.776	Caspase-8
2	9606.ENSP00000301838	0.666	FAS-associated death domain protein
3	9606.ENSP00000229390	0.653	Serine/arginine-rich splicing factor 9
4	9606.ENSP00000312664	0.543	Caspase-2
5	9606.ENSP00000264009	0.513	Heat shock factor protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0089720	0.999	caspase binding
GO:0042802	0.992	identical protein binding
GO:0098772	0.972	molecular function regulator activity
GO:0019904	0.968	protein domain specific binding
GO:0030234	0.963	enzyme regulator activity
GO:1901363	0.921	heterocyclic compound binding
GO:0097159	0.919	organic cyclic compound binding
GO:0061135	0.911	endopeptidase regulator activity
GO:0030414	0.907	peptidase inhibitor activity
GO:0004869	0.904	cysteine-type endopeptidase inhibitor activity
GO:0043028	0.901	cysteine-type endopeptidase regulator activity involved in apoptotic process
GO:0003676	0.882	nucleic acid binding
GO:0043027	0.865	cysteine-type endopeptidase inhibitor activity involved in apoptotic process
GO:0003723	0.846	RNA binding
GO:0046872	0.828	metal ion binding
GO:0005509	0.818	calcium ion binding
GO:0019902	0.379	phosphatase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0080090	0.970	regulation of primary metabolic process
GO:1902531	0.956	regulation of intracellular signal transduction
GO:0043066	0.956	negative regulation of apoptotic process
GO:0051171	0.953	regulation of nitrogen compound metabolic process
GO:0048585	0.949	negative regulation of response to stimulus
GO:0065009	0.939	regulation of molecular function
GO:0009968	0.935	negative regulation of signal transduction
GO:0010468	0.933	regulation of gene expression
GO:0051246	0.914	regulation of protein metabolic process
GO:0008152	0.894	metabolic process
GO:0050790	0.885	regulation of catalytic activity
GO:0080135	0.876	regulation of cellular response to stress
GO:0050896	0.851	response to stimulus
GO:0071704	0.847	organic substance metabolic process
GO:0044238	0.842	primary metabolic process
GO:0006807	0.830	nitrogen compound metabolic process
GO:2000116	0.830	regulation of cysteine-type endopeptidase activity
GO:0071840	0.735	cellular component organization or biogenesis
GO:0016043	0.720	cellular component organization
GO:0043170	0.706	macromolecule metabolic process
GO:0051716	0.674	cellular response to stimulus
GO:0010605	0.592	negative regulation of macromolecule metabolic process
GO:0023052	0.553	signaling
GO:0048518	0.549	positive regulation of biological process
GO:2001233	0.539	regulation of apoptotic signaling pathway
GO:0007154	0.536	cell communication
GO:0007165	0.534	signal transduction
GO:0012501	0.527	programmed cell death
GO:0048522	0.516	positive regulation of cellular process
GO:0051172	0.474	negative regulation of nitrogen compound metabolic process
GO:0006915	0.434	apoptotic process
GO:2001236	0.432	regulation of extrinsic apoptotic signaling pathway
GO:0006950	0.427	response to stress
GO:0043281	0.427	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0033043	0.416	regulation of organelle organization
GO:0051179	0.395	localization
GO:0043086	0.385	negative regulation of catalytic activity
GO:0051129	0.385	negative regulation of cellular component organization
GO:0010639	0.369	negative regulation of organelle organization
GO:2001234	0.355	negative regulation of apoptotic signaling pathway
GO:0010629	0.337	negative regulation of gene expression
GO:0044237	0.331	cellular metabolic process
GO:0097190	0.328	apoptotic signaling pathway
GO:1902532	0.325	negative regulation of intracellular signal transduction
GO:0031323	0.318	regulation of cellular metabolic process
GO:0010467	0.310	gene expression
GO:0006810	0.308	transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0031981	0.994	nuclear lumen
GO:0005739	0.991	mitochondrion
GO:0043232	0.988	intracellular non-membrane-bounded organelle
GO:0005829	0.969	cytosol
GO:0005730	0.647	nucleolus
GO:0005654	0.569	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]