StarFunc result for job id O75019

User Input

>input (489 residues)
MTPIVTVLICLRLSLGPRTHVQAGTLPKPTLWAEPGSVITQGSPVTLWCQGILETQEYRL
YREKKTAPWITRIPQEIVKKGQFPIPSITWEHTGRYRCFYGSHTAGWSEPSDPLELVVTG
AYIKPTLSALPSPVVTSGGNVTLHCVSQVAFGSFILCKEGEDEHPQCLNSQPRTHGWSRA
IFSVGPVSPSRRWSYRCYAYDSNSPHVWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPGE
SLTLQCVSDVSYDRFVLYKEGERDFLQLPGPQPQAGLSQANFTLGPVSRSYGGQYRCSGA
YNLSSEWSAPSDPLDILIAGQFRGRPFISVHPGPTVASGENVTLLCQSWGPFHTFLLTKA
GAADAPLRLRSIHEYPKYQAEFPMSPVTSAHSGTYRCYGSLSSNPYLLSHPSDSLELMVS
GAAETLSPPQNKSDSKAGAANTLSPSQNKTASHPQDYTVENLIRMGIAGLVLVVLGILLF
EAQHSQRSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75019	1.000	1.000	6.297E-96	489	1.000	1.000	O75019.pdb.gz	LIRA1_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 1 OS=Homo sapiens OX=9606 GN=LILRA1 PE=2 SV=1
2	AFDB:Q8N6C8	0.799	0.886	3.602E-80	439	0.765	0.852	Q8N6C8.pdb.gz	LIRA3_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 3 OS=Homo sapiens OX=9606 GN=LILRA3 PE=1 SV=3
3	AFDB:Q8N423	0.803	0.661	1.102E-78	598	0.771	0.630	Q8N423.pdb.gz	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
4	AFDB:Q8NHL6	0.814	0.617	3.299E-76	650	0.763	0.574	Q8NHL6.pdb.gz	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
5	AFDB:Q8N149	0.773	0.783	9.451E-72	483	0.789	0.799	Q8N149.pdb.gz	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3
6	AFDB:O75023	0.757	0.634	6.304E-63	590	0.573	0.475	O75023.pdb.gz	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
7	AFDB:P59901	0.622	0.612	8.604E-63	499	0.658	0.645	P59901.pdb.gz	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
8	AFDB:O75022	0.749	0.588	1.580E-59	631	0.601	0.466	O75022.pdb.gz	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
9	AFDB:P97484	0.677	0.409	7.231E-48	841	0.452	0.263	P97484.pdb.gz	LIRB3_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Mus musculus OX=10090 GN=Lilrb3 PE=1 SV=1
10	AFDB:P43630	0.525	0.562	3.619E-33	455	0.274	0.295	P43630.pdb.gz	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
11	PDB:5oj2B	0.172	0.128	2.755E-11	692	0.166	0.117	5oj2B.pdb.gz
12	PDB:1e07A	0.178	0.143	1.060E-10	642	0.131	0.100	1e07A.pdb.gz
13	PDB:7vonA	0.185	0.082	2.989E-10	1399	0.115	0.040	7vonA.pdb.gz
14	PDB:7q1yA	0.166	0.075	1.742E-9	1374	0.112	0.040	7q1yA.pdb.gz
15	PDB:1hzhH	0.176	0.185	1.248E-8	457	0.141	0.151	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
16	PDB:4rtdA	0.167	0.086	2.579E-8	1122	0.112	0.049	4rtdA.pdb.gz
17	PDB:7q5zA	0.170	0.077	2.579E-8	1344	0.102	0.037	7q5zA.pdb.gz
18	PDB:5a42A	0.164	0.062	3.013E-8	1597	0.110	0.034	5a42A.pdb.gz
19	PDB:4ziqA	0.176	0.071	4.561E-8	1450	0.104	0.035	4ziqA.pdb.gz
20	PDB:4lnvB	0.150	0.076	4.023E-7	1063	0.094	0.043	4lnvB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75019	0.0	997	489	1.000	1.000	LIRA1_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 1 OS=Homo sapiens OX=9606 GN=LILRA1 PE=2 SV=1
2	O75022	0.0	571	631	0.595	0.461	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
3	P59901	0.0	585	499	0.658	0.645	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
4	Q8N149	0.0	723	483	0.796	0.805	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3
5	Q8N423	0.0	719	597	0.767	0.628	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
6	Q8N6C8	0.0	746	439	0.765	0.852	LIRA3_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 3 OS=Homo sapiens OX=9606 GN=LILRA3 PE=1 SV=3
7	Q8NHL6	0.0	712	650	0.726	0.546	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
8	O75023	2.40e-175	507	590	0.556	0.461	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
9	P97484	2.17e-133	407	841	0.448	0.260	LIRB3_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Mus musculus OX=10090 GN=Lilrb3 PE=1 SV=1
10	Q8K4V6	3.37e-129	392	697	0.446	0.313	Q8K4V6_MOUSE Paired immunoglobulin-like receptor B (Fragment) OS=Mus musculus OX=10090 GN=Pirb PE=1 SV=1
11	A6NI73	6.53e-81	255	299	0.274	0.448	LIRA5_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 5 OS=Homo sapiens OX=9606 GN=LILRA5 PE=1 SV=1
12	Q8NHJ6	1.70e-67	225	448	0.258	0.281	LIRB4_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 4 OS=Homo sapiens OX=9606 GN=LILRB4 PE=1 SV=3
13	Q8N743	3.50e-66	220	410	0.274	0.327	KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 OS=Homo sapiens OX=9606 GN=KIR3DL3 PE=1 SV=2
14	P43630	8.90e-62	210	455	0.274	0.295	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
15	P43629	5.40e-59	202	444	0.264	0.291	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1
16	Q14943	4.45e-58	198	382	0.258	0.330	KI3S1_HUMAN Killer cell immunoglobulin-like receptor 3DS1 OS=Homo sapiens OX=9606 GN=KIR3DS1 PE=1 SV=2
17	Q64281	6.45e-58	196	335	0.221	0.322	LRB4A_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4A OS=Mus musculus OX=10090 GN=Lilrb4a PE=1 SV=1
18	Q61450	4.48e-56	191	303	0.204	0.330	LRB4B_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4B OS=Mus musculus OX=10090 GN=Lilrb4b PE=1 SV=1
19	Q28109	1.19e-50	175	264	0.241	0.447	Q28109_BOVIN FC gamma 2 receptor OS=Bos taurus OX=9913 PE=1 SV=1
20	P43631	4.93e-44	159	304	0.194	0.312	KI2S2_HUMAN Killer cell immunoglobulin-like receptor 2DS2 OS=Homo sapiens OX=9606 GN=KIR2DS2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00047 ig	4e-11	54.3	Immunoglobulin domain
2	PF13895 Ig_2	2e-28	109.8	Immunoglobulin domain
3	PF13927 Ig_3	1.1e-21	88.4	Immunoglobulin domain
4	PF07686 V-set	1	21.0	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000251372

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356946	0.898	Low affinity immunoglobulin gamma Fc region receptor III-A
2	9606.ENSP00000365402	0.897	HLA class I histocompatibility antigen, Cw-7 alpha chain
3	9606.ENSP00000433642	0.885	Low affinity immunoglobulin gamma Fc region receptor III-B
4	9606.ENSP00000358165	0.879	High affinity immunoglobulin gamma Fc receptor I
5	9606.ENSP00000351497	0.872	Low affinity immunoglobulin gamma Fc region receptor II-b
6	9606.ENSP00000271450	0.865	Low affinity immunoglobulin gamma Fc region receptor II-a
7	9606.ENSP00000262629	0.832	TYRO protein tyrosine kinase-binding protein
8	9606.ENSP00000329507	0.827	CMRF35-like molecule 6
9	9606.ENSP00000412927	0.816	HLA class I histocompatibility antigen, alpha chain G
10	9606.ENSP00000259951	0.781	HLA class I histocompatibility antigen, alpha chain F
11	9606.ENSP00000357123	0.744	Myeloid cell nuclear differentiation antigen
12	9606.ENSP00000365817	0.715	HLA class I histocompatibility antigen, alpha chain E
13	9606.ENSP00000379873	0.710	HLA class I histocompatibility antigen, A-3 alpha chain
14	9606.ENSP00000303276	0.694	Non-secretory ribonuclease
15	9606.ENSP00000364907	0.694	Tyrosine-protein kinase SYK
16	9606.ENSP00000399168	0.685	HLA class I histocompatibility antigen, B-7 alpha chain
17	9606.ENSP00000289902	0.683	High affinity immunoglobulin epsilon receptor subunit gamma
18	9606.ENSP00000312082	0.682	Toll-like receptor 8
19	9606.ENSP00000391592	0.678	Tyrosine-protein phosphatase non-receptor type 6
20	9606.ENSP00000452780	0.649	Beta-2-microglobulin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038023	1.000	signaling receptor activity
GO:0005515	1.000	protein binding
GO:0004888	0.967	transmembrane signaling receptor activity
GO:0003823	0.853	antigen binding
GO:0005102	0.406	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0009987	0.997	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0051716	0.985	cellular response to stimulus
GO:0002682	0.975	regulation of immune system process
GO:0023052	0.973	signaling
GO:0007154	0.972	cell communication
GO:0048583	0.955	regulation of response to stimulus
GO:0007165	0.952	signal transduction
GO:0050776	0.942	regulation of immune response
GO:0007166	0.935	cell surface receptor signaling pathway
GO:0006950	0.927	response to stress
GO:0006952	0.904	defense response
GO:0002376	0.696	immune system process
GO:0002764	0.692	immune response-regulating signaling pathway
GO:0048518	0.653	positive regulation of biological process
GO:0048519	0.632	negative regulation of biological process
GO:0051239	0.608	regulation of multicellular organismal process
GO:0019222	0.456	regulation of metabolic process
GO:0002684	0.441	positive regulation of immune system process
GO:0060255	0.439	regulation of macromolecule metabolic process
GO:0006955	0.435	immune response
GO:0048584	0.407	positive regulation of response to stimulus
GO:0048523	0.397	negative regulation of cellular process
GO:0045088	0.395	regulation of innate immune response
GO:0002768	0.353	immune response-regulating cell surface receptor signaling pathway
GO:0048522	0.333	positive regulation of cellular process
GO:0032501	0.323	multicellular organismal process
GO:0009605	0.320	response to external stimulus
GO:0010468	0.315	regulation of gene expression
GO:0050778	0.303	positive regulation of immune response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.996	plasma membrane
GO:0012505	0.956	endomembrane system
GO:0031982	0.907	vesicle
GO:0031410	0.888	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]