StarFunc result for job id O75022

User Input

>input (631 residues)
MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRL
HKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGA
YSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQAL
FPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQS
LTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAH
NLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEG
AAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSG
HSGGSSLPPTGPPSTPGLGRYLEVLIGVSVAFVLLLFLLLFLLLRRQRHSKHRTSDQRKT
DFQRPAGAAETEPKDRGLLRRSSPAADVQEENLYAAVKDTQSEDRVELDSQSPHDEDPQA
VTYAPVKHSSPRREMASPPSSLSGEFLDTKDRQVEEDRQMDTEAAASEASQDVTYAQLHS
LTLRRKATEPPPSQEGEPPAEPSIYATLAIH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75022	1.000	1.000	0.000	631	1.000	1.000	O75022.pdb.gz	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
2	AFDB:O75023	0.606	0.646	4.377E-72	590	0.651	0.697	O75023.pdb.gz	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
3	AFDB:Q8N423	0.602	0.633	6.887E-72	598	0.666	0.702	Q8N423.pdb.gz	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
4	AFDB:P59901	0.613	0.756	9.980E-67	499	0.518	0.655	P59901.pdb.gz	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
5	AFDB:P97484	0.578	0.440	4.144E-65	841	0.518	0.389	P97484.pdb.gz	LIRB3_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Mus musculus OX=10090 GN=Lilrb3 PE=1 SV=1
6	AFDB:Q8N149	0.603	0.777	5.763E-63	483	0.477	0.623	Q8N149.pdb.gz	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3
7	AFDB:Q8NHJ6	0.206	0.284	3.345E-44	448	0.517	0.728	Q8NHJ6.pdb.gz	LIRB4_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 4 OS=Homo sapiens OX=9606 GN=LILRB4 PE=1 SV=3
8	AFDB:A6NI73	0.315	0.657	1.558E-30	299	0.250	0.528	A6NI73.pdb.gz	LIRA5_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 5 OS=Homo sapiens OX=9606 GN=LILRA5 PE=1 SV=1
9	AFDB:Q64281	0.246	0.453	2.971E-27	335	0.266	0.501	Q64281.pdb.gz	LRB4A_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4A OS=Mus musculus OX=10090 GN=Lilrb4a PE=1 SV=1
10	AFDB:Q61450	0.254	0.516	5.315E-25	303	0.219	0.455	Q61450.pdb.gz	LRB4B_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4B OS=Mus musculus OX=10090 GN=Lilrb4b PE=1 SV=1
11	PDB:1e07A	0.147	0.145	4.231E-11	642	0.087	0.086	1e07A.pdb.gz
12	PDB:7q1yA	0.129	0.072	4.450E-11	1374	0.101	0.047	7q1yA.pdb.gz
13	PDB:5oj2B	0.141	0.134	3.688E-10	692	0.108	0.098	5oj2B.pdb.gz
14	PDB:1hzhH	0.138	0.177	1.062E-9	457	0.097	0.133	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
15	PDB:4rtdA	0.138	0.087	1.848E-9	1122	0.074	0.042	4rtdA.pdb.gz
16	PDB:7vonA	0.142	0.078	3.057E-9	1399	0.082	0.037	7vonA.pdb.gz
17	PDB:7q5zA	0.139	0.077	3.381E-9	1344	0.086	0.040	7q5zA.pdb.gz
18	PDB:4ziqA	0.133	0.071	4.349E-9	1450	0.079	0.034	4ziqA.pdb.gz
19	PDB:1igaA	0.154	0.190	5.883E-9	475	0.106	0.141	1igaA.pdb.gz
20	PDB:1igtB	0.148	0.194	1.781E-8	444	0.097	0.137	1igtB.pdb.gz	Refined structure of an intact IgG2a monoclonal antibody.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75019	0.0	570	489	0.461	0.595	LIRA1_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 1 OS=Homo sapiens OX=9606 GN=LILRA1 PE=2 SV=1
2	O75022	0.0	1291	631	1.000	1.000	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
3	O75023	0.0	696	590	0.631	0.675	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
4	P59901	0.0	603	499	0.487	0.615	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
5	P97484	0.0	574	841	0.518	0.389	LIRB3_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Mus musculus OX=10090 GN=Lilrb3 PE=1 SV=1
6	Q8N149	0.0	565	483	0.463	0.605	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3
7	Q8N423	0.0	699	597	0.640	0.677	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
8	Q8N6C8	0.0	551	439	0.456	0.656	LIRA3_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 3 OS=Homo sapiens OX=9606 GN=LILRA3 PE=1 SV=3
9	Q8NHL6	0.0	827	650	0.729	0.708	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
10	Q8K4V6	8.80e-149	448	697	0.407	0.369	Q8K4V6_MOUSE Paired immunoglobulin-like receptor B (Fragment) OS=Mus musculus OX=10090 GN=Pirb PE=1 SV=1
11	Q8NHJ6	2.07e-140	418	448	0.406	0.571	LIRB4_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 4 OS=Homo sapiens OX=9606 GN=LILRB4 PE=1 SV=3
12	A6NI73	6.31e-102	313	299	0.250	0.528	LIRA5_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 5 OS=Homo sapiens OX=9606 GN=LILRA5 PE=1 SV=1
13	P43630	4.98e-81	265	455	0.287	0.398	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
14	Q8N743	9.30e-78	254	410	0.266	0.410	KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 OS=Homo sapiens OX=9606 GN=KIR3DL3 PE=1 SV=2
15	Q14943	3.47e-73	242	382	0.231	0.382	KI3S1_HUMAN Killer cell immunoglobulin-like receptor 3DS1 OS=Homo sapiens OX=9606 GN=KIR3DS1 PE=1 SV=2
16	P43629	3.53e-72	241	444	0.227	0.322	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1
17	Q64281	3.72e-65	219	335	0.185	0.349	LRB4A_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4A OS=Mus musculus OX=10090 GN=Lilrb4a PE=1 SV=1
18	Q61450	2.36e-63	213	303	0.171	0.356	LRB4B_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4B OS=Mus musculus OX=10090 GN=Lilrb4b PE=1 SV=1
19	P43631	2.11e-54	189	304	0.181	0.375	KI2S2_HUMAN Killer cell immunoglobulin-like receptor 2DS2 OS=Homo sapiens OX=9606 GN=KIR2DS2 PE=1 SV=2
20	P43632	4.30e-54	189	304	0.181	0.375	KI2S4_HUMAN Killer cell immunoglobulin-like receptor 2DS4 OS=Homo sapiens OX=9606 GN=KIR2DS4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	1.2e+02	14.2	Immunoglobulin I-set domain
2	PF00047 ig	1.5e-13	62.1	Immunoglobulin domain
3	PF13895 Ig_2	1.5e-25	100.6	Immunoglobulin domain
4	PF13927 Ig_3	8.2e-19	79.3	Immunoglobulin domain
5	PF05177 RCSD	1.2e+02	15.0	RCSD region
6	PF07686 V-set	2.7	19.6	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000245620

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351497	0.910	Low affinity immunoglobulin gamma Fc region receptor II-b
2	9606.ENSP00000356946	0.890	Low affinity immunoglobulin gamma Fc region receptor III-A
3	9606.ENSP00000433642	0.886	Low affinity immunoglobulin gamma Fc region receptor III-B
4	9606.ENSP00000271450	0.870	Low affinity immunoglobulin gamma Fc region receptor II-a
5	9606.ENSP00000337838	0.856	Reticulon-4
6	9606.ENSP00000358165	0.856	High affinity immunoglobulin gamma Fc receptor I
7	9606.ENSP00000391592	0.839	Tyrosine-protein phosphatase non-receptor type 6
8	9606.ENSP00000285670	0.792	SAM domain-containing protein SAMSN-1
9	9606.ENSP00000043402	0.782	Reticulon-4 receptor
10	9606.ENSP00000364907	0.748	Tyrosine-protein kinase SYK
11	9606.ENSP00000412927	0.735	HLA class I histocompatibility antigen, alpha chain G
12	9606.ENSP00000247271	0.734	Oligodendrocyte-myelin glycoprotein
13	9606.ENSP00000329507	0.731	CMRF35-like molecule 6
14	9606.ENSP00000399168	0.709	HLA class I histocompatibility antigen, B-7 alpha chain
15	9606.ENSP00000259951	0.701	HLA class I histocompatibility antigen, alpha chain F
16	9606.ENSP00000365402	0.697	HLA class I histocompatibility antigen, Cw-7 alpha chain
17	9606.ENSP00000365817	0.692	HLA class I histocompatibility antigen, alpha chain E
18	9606.ENSP00000379873	0.689	HLA class I histocompatibility antigen, A-3 alpha chain
19	9606.ENSP00000340944	0.639	Tyrosine-protein phosphatase non-receptor type 11
20	9606.ENSP00000452780	0.629	Beta-2-microglobulin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004888	1.000	transmembrane signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.994	response to stimulus
GO:0009987	0.994	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0051716	0.982	cellular response to stimulus
GO:0023052	0.975	signaling
GO:0007154	0.975	cell communication
GO:0002682	0.974	regulation of immune system process
GO:0048519	0.963	negative regulation of biological process
GO:0007165	0.962	signal transduction
GO:1902105	0.956	regulation of leukocyte differentiation
GO:0002683	0.953	negative regulation of immune system process
GO:0051241	0.935	negative regulation of multicellular organismal process
GO:0006950	0.933	response to stress
GO:0048523	0.919	negative regulation of cellular process
GO:0006952	0.913	defense response
GO:0002694	0.908	regulation of leukocyte activation
GO:0007166	0.908	cell surface receptor signaling pathway
GO:0019222	0.876	regulation of metabolic process
GO:0001817	0.873	regulation of cytokine production
GO:0002376	0.862	immune system process
GO:0048518	0.846	positive regulation of biological process
GO:0002764	0.825	immune response-regulating signaling pathway
GO:0048522	0.791	positive regulation of cellular process
GO:0051240	0.703	positive regulation of multicellular organismal process
GO:0051249	0.634	regulation of lymphocyte activation
GO:0010721	0.594	negative regulation of cell development
GO:0006955	0.531	immune response
GO:0045637	0.528	regulation of myeloid cell differentiation
GO:1903707	0.528	negative regulation of hemopoiesis
GO:0032501	0.515	multicellular organismal process
GO:0002695	0.514	negative regulation of leukocyte activation
GO:1902106	0.512	negative regulation of leukocyte differentiation
GO:0002768	0.488	immune response-regulating cell surface receptor signaling pathway
GO:0002684	0.484	positive regulation of immune system process
GO:0002761	0.473	regulation of myeloid leukocyte differentiation
GO:0009893	0.459	positive regulation of metabolic process
GO:0048585	0.449	negative regulation of response to stimulus
GO:0022407	0.449	regulation of cell-cell adhesion
GO:0080134	0.447	regulation of response to stress
GO:0010604	0.447	positive regulation of macromolecule metabolic process
GO:0002762	0.444	negative regulation of myeloid leukocyte differentiation
GO:0031347	0.436	regulation of defense response
GO:0045670	0.435	regulation of osteoclast differentiation
GO:0010646	0.432	regulation of cell communication
GO:0032101	0.417	regulation of response to external stimulus
GO:0051250	0.416	negative regulation of lymphocyte activation
GO:0023051	0.408	regulation of signaling
GO:0048584	0.403	positive regulation of response to stimulus
GO:0080090	0.396	regulation of primary metabolic process
GO:0009966	0.377	regulation of signal transduction
GO:0050778	0.376	positive regulation of immune response
GO:0032502	0.373	developmental process
GO:0031323	0.360	regulation of cellular metabolic process
GO:0045088	0.346	regulation of innate immune response
GO:0050867	0.308	positive regulation of cell activation
GO:0051171	0.307	regulation of nitrogen compound metabolic process
GO:0048856	0.305	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0012505	0.997	endomembrane system
GO:0031982	0.996	vesicle
GO:0043231	0.990	intracellular membrane-bounded organelle
GO:0005737	0.986	cytoplasm
GO:0031090	0.958	organelle membrane
GO:0030659	0.948	cytoplasmic vesicle membrane
GO:0099503	0.946	secretory vesicle
GO:0030141	0.944	secretory granule
GO:0098588	0.941	bounding membrane of organelle
GO:0005576	0.891	extracellular region
GO:0030667	0.877	secretory granule membrane
GO:0005615	0.854	extracellular space
GO:0009986	0.712	cell surface
GO:0070062	0.633	extracellular exosome
GO:0098552	0.391	side of membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]