StarFunc result for job id O75023

User Input

>input (590 residues)
MTLTLSVLICLGLSVGPRTCVQAGTLPKPTLWAEPASVIARGKPVTLWCQGPLETEEYRL
DKEGLPWARKRQNPLEPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATGF
YAEPTLLALPSPVVASGGNVTLQCDTLDGLLTFVLVEEEQKLPRTLYSQKLPKGPSQALF
PVGPVTPSCRWRFRCYYYYRKNPQVWSNPSDLLEILVPGVSRKPSLLIPQGSVVARGGSL
TLQCRSDVGYDIFVLYKEGEHDLVQGSGQQPQAGLSQANFTLGPVSRSHGGQYRCYGAHN
LSPRWSAPSDPLDILIAGLIPDIPALSVQPGPKVASGENVTLLCQSWHQIDTFFLTKEGA
AHPPLCLKSKYQSYRHQAEFSMSPVTSAQGGTYRCYSAIRSYPYLLSSPSYPQELVVSGP
SGDPSLSPTGSTPTPGPEDQPLTPTGLDPQSGLGRHLGVVTGVSVAFVLLLFLLLFLLLR
HRHQSKHRTSAHFYRPAGAAGPEPKDQGLQKRASPVADIQEEILNAAVKDTQPKDGVEMD
ARAAASEAPQDVTYAQLHSLTLRREATEPPPSQEREPPAEPSIYAPLAIH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75023	1.000	1.000	0.000	590	1.000	1.000	O75023.pdb.gz	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
2	AFDB:Q8N423	0.715	0.706	1.727E-74	598	0.669	0.661	Q8N423.pdb.gz	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
3	AFDB:O75022	0.648	0.608	7.939E-73	631	0.685	0.640	O75022.pdb.gz	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
4	AFDB:Q8NHL6	0.654	0.597	2.319E-72	650	0.666	0.605	Q8NHL6.pdb.gz	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
5	AFDB:O75019	0.635	0.758	8.263E-62	489	0.471	0.569	O75019.pdb.gz	LIRA1_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 1 OS=Homo sapiens OX=9606 GN=LILRA1 PE=2 SV=1
6	AFDB:P59901	0.560	0.647	7.050E-61	499	0.475	0.561	P59901.pdb.gz	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
7	AFDB:Q8N149	0.642	0.779	1.957E-60	483	0.478	0.584	Q8N149.pdb.gz	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3
8	AFDB:Q8N6C8	0.661	0.883	8.550E-59	439	0.453	0.608	Q8N6C8.pdb.gz	LIRA3_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 3 OS=Homo sapiens OX=9606 GN=LILRA3 PE=1 SV=3
9	AFDB:P97484	0.618	0.443	5.914E-57	841	0.492	0.345	P97484.pdb.gz	LIRB3_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Mus musculus OX=10090 GN=Lilrb3 PE=1 SV=1
10	AFDB:Q8NHJ6	0.183	0.238	1.526E-34	448	0.442	0.583	Q8NHJ6.pdb.gz	LIRB4_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 4 OS=Homo sapiens OX=9606 GN=LILRB4 PE=1 SV=3
11	PDB:1e07A	0.156	0.146	4.524E-11	642	0.102	0.093	1e07A.pdb.gz
12	PDB:5oj2B	0.179	0.159	1.621E-10	692	0.120	0.103	5oj2B.pdb.gz
13	PDB:7vonA	0.147	0.077	3.312E-10	1399	0.092	0.039	7vonA.pdb.gz
14	PDB:1hzhH	0.149	0.178	6.767E-10	457	0.114	0.147	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
15	PDB:7q1yA	0.150	0.078	1.127E-9	1374	0.098	0.042	7q1yA.pdb.gz
16	PDB:1igtB	0.154	0.189	1.307E-8	444	0.102	0.135	1igtB.pdb.gz	Refined structure of an intact IgG2a monoclonal antibody.
17	PDB:7q5zA	0.153	0.079	2.068E-8	1344	0.097	0.042	7q5zA.pdb.gz
18	PDB:4rtdA	0.145	0.087	4.227E-8	1122	0.102	0.053	4rtdA.pdb.gz
19	PDB:1igaA	0.146	0.172	6.358E-8	475	0.110	0.137	1igaA.pdb.gz
20	PDB:4ziqA	0.143	0.071	9.089E-8	1450	0.093	0.038	4ziqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75022	0.0	716	631	0.698	0.653	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
2	O75023	0.0	1191	590	0.998	0.998	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
3	Q8N423	0.0	722	597	0.685	0.677	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
4	Q8NHL6	0.0	655	650	0.683	0.620	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
5	P59901	1.88e-176	510	499	0.466	0.551	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
6	Q8N149	2.20e-176	509	483	0.473	0.578	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3
7	O75019	2.46e-175	507	489	0.461	0.556	LIRA1_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 1 OS=Homo sapiens OX=9606 GN=LILRA1 PE=2 SV=1
8	Q8N6C8	1.49e-168	488	439	0.453	0.608	LIRA3_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 3 OS=Homo sapiens OX=9606 GN=LILRA3 PE=1 SV=3
9	P97484	1.37e-155	469	841	0.497	0.348	LIRB3_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Mus musculus OX=10090 GN=Lilrb3 PE=1 SV=1
10	Q8K4V6	6.36e-133	406	697	0.410	0.347	Q8K4V6_MOUSE Paired immunoglobulin-like receptor B (Fragment) OS=Mus musculus OX=10090 GN=Pirb PE=1 SV=1
11	Q8NHJ6	5.06e-97	305	448	0.351	0.462	LIRB4_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 4 OS=Homo sapiens OX=9606 GN=LILRB4 PE=1 SV=3
12	A6NI73	3.47e-85	269	299	0.242	0.478	LIRA5_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 5 OS=Homo sapiens OX=9606 GN=LILRA5 PE=1 SV=1
13	P43630	1.11e-61	213	455	0.275	0.356	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
14	Q8N743	1.52e-59	206	410	0.258	0.371	KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 OS=Homo sapiens OX=9606 GN=KIR3DL3 PE=1 SV=2
15	Q14943	2.87e-58	201	382	0.227	0.351	KI3S1_HUMAN Killer cell immunoglobulin-like receptor 3DS1 OS=Homo sapiens OX=9606 GN=KIR3DS1 PE=1 SV=2
16	P43629	2.57e-56	198	444	0.261	0.347	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1
17	Q64281	2.42e-52	184	335	0.180	0.316	LRB4A_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4A OS=Mus musculus OX=10090 GN=Lilrb4a PE=1 SV=1
18	Q61450	1.72e-49	176	303	0.163	0.317	LRB4B_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4B OS=Mus musculus OX=10090 GN=Lilrb4b PE=1 SV=1
19	P43631	3.04e-46	167	304	0.200	0.388	KI2S2_HUMAN Killer cell immunoglobulin-like receptor 2DS2 OS=Homo sapiens OX=9606 GN=KIR2DS2 PE=1 SV=2
20	P43632	4.47e-45	164	304	0.195	0.378	KI2S4_HUMAN Killer cell immunoglobulin-like receptor 2DS4 OS=Homo sapiens OX=9606 GN=KIR2DS4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	2.4e+02	13.2	Immunoglobulin I-set domain
2	PF00047 ig	7.9e-13	59.7	Immunoglobulin domain
3	PF13895 Ig_2	2.4e-22	90.3	Immunoglobulin domain
4	PF13927 Ig_3	2e-14	65.2	Immunoglobulin domain
5	PF03939 Ribosomal_L23eN	9.5e+02	11.4	Ribosomal protein L23, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000406478

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351497	0.825	Low affinity immunoglobulin gamma Fc region receptor II-b
2	9606.ENSP00000356946	0.824	Low affinity immunoglobulin gamma Fc region receptor III-A
3	9606.ENSP00000391592	0.824	Tyrosine-protein phosphatase non-receptor type 6
4	9606.ENSP00000433642	0.818	Low affinity immunoglobulin gamma Fc region receptor III-B
5	9606.ENSP00000358165	0.814	High affinity immunoglobulin gamma Fc receptor I
6	9606.ENSP00000271450	0.813	Low affinity immunoglobulin gamma Fc region receptor II-a
7	9606.ENSP00000412927	0.721	HLA class I histocompatibility antigen, alpha chain G
8	9606.ENSP00000259951	0.687	HLA class I histocompatibility antigen, alpha chain F
9	9606.ENSP00000365817	0.680	HLA class I histocompatibility antigen, alpha chain E
10	9606.ENSP00000329507	0.677	CMRF35-like molecule 6
11	9606.ENSP00000365402	0.650	HLA class I histocompatibility antigen, Cw-7 alpha chain
12	9606.ENSP00000379873	0.635	HLA class I histocompatibility antigen, A-3 alpha chain
13	9606.ENSP00000399168	0.627	HLA class I histocompatibility antigen, B-7 alpha chain
14	9606.ENSP00000364907	0.626	Tyrosine-protein kinase SYK
15	9606.ENSP00000452780	0.621	Beta-2-microglobulin
16	9606.ENSP00000340944	0.535	Tyrosine-protein phosphatase non-receptor type 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004888	1.000	transmembrane signaling receptor activity
GO:0005102	0.487	signaling receptor binding
GO:0044877	0.484	protein-containing complex binding
GO:0042277	0.389	peptide binding
GO:0003823	0.383	antigen binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.994	response to stimulus
GO:0009987	0.992	cellular process
GO:0050794	0.992	regulation of cellular process
GO:0023052	0.987	signaling
GO:0051716	0.984	cellular response to stimulus
GO:0007165	0.967	signal transduction
GO:0006950	0.961	response to stress
GO:0051239	0.959	regulation of multicellular organismal process
GO:0006952	0.954	defense response
GO:0048519	0.936	negative regulation of biological process
GO:0002682	0.927	regulation of immune system process
GO:0007166	0.897	cell surface receptor signaling pathway
GO:0048523	0.874	negative regulation of cellular process
GO:0048518	0.871	positive regulation of biological process
GO:0019222	0.866	regulation of metabolic process
GO:0060255	0.858	regulation of macromolecule metabolic process
GO:0050776	0.857	regulation of immune response
GO:0002376	0.856	immune system process
GO:0048522	0.850	positive regulation of cellular process
GO:0050865	0.778	regulation of cell activation
GO:0010468	0.709	regulation of gene expression
GO:0002684	0.700	positive regulation of immune system process
GO:0001817	0.653	regulation of cytokine production
GO:0002694	0.627	regulation of leukocyte activation
GO:0051249	0.622	regulation of lymphocyte activation
GO:0002683	0.604	negative regulation of immune system process
GO:0048584	0.603	positive regulation of response to stimulus
GO:0032501	0.596	multicellular organismal process
GO:0051240	0.558	positive regulation of multicellular organismal process
GO:0080134	0.545	regulation of response to stress
GO:0006955	0.536	immune response
GO:0002764	0.536	immune response-regulating signaling pathway
GO:0002768	0.534	immune response-regulating cell surface receptor signaling pathway
GO:0009893	0.525	positive regulation of metabolic process
GO:0022407	0.509	regulation of cell-cell adhesion
GO:0002831	0.504	regulation of response to biotic stimulus
GO:0010604	0.494	positive regulation of macromolecule metabolic process
GO:0032101	0.489	regulation of response to external stimulus
GO:0031347	0.484	regulation of defense response
GO:1903037	0.469	regulation of leukocyte cell-cell adhesion
GO:0050863	0.467	regulation of T cell activation
GO:0045088	0.459	regulation of innate immune response
GO:0032502	0.424	developmental process
GO:0032102	0.415	negative regulation of response to external stimulus
GO:0050867	0.410	positive regulation of cell activation
GO:0002697	0.409	regulation of immune effector process
GO:1902105	0.409	regulation of leukocyte differentiation
GO:0002703	0.402	regulation of leukocyte mediated immunity
GO:0051251	0.392	positive regulation of lymphocyte activation
GO:0031348	0.384	negative regulation of defense response
GO:0002706	0.382	regulation of lymphocyte mediated immunity
GO:0050777	0.382	negative regulation of immune response
GO:0001819	0.380	positive regulation of cytokine production
GO:0050778	0.378	positive regulation of immune response
GO:0002822	0.374	regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0002709	0.359	regulation of T cell mediated immunity
GO:0001775	0.358	cell activation
GO:0031341	0.356	regulation of cell killing
GO:0002698	0.353	negative regulation of immune effector process
GO:0002252	0.346	immune effector process
GO:0042127	0.337	regulation of cell population proliferation
GO:0009607	0.331	response to biotic stimulus
GO:0002704	0.329	negative regulation of leukocyte mediated immunity
GO:0002707	0.322	negative regulation of lymphocyte mediated immunity
GO:0051241	0.308	negative regulation of multicellular organismal process
GO:0044419	0.305	biological process involved in interspecies interaction between organisms

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.985	organelle
GO:0031982	0.979	vesicle
GO:0012505	0.975	endomembrane system
GO:0005737	0.974	cytoplasm
GO:0043231	0.969	intracellular membrane-bounded organelle
GO:0032991	0.953	protein-containing complex
GO:0097708	0.916	intracellular vesicle
GO:0031410	0.912	cytoplasmic vesicle
GO:0031090	0.910	organelle membrane
GO:0009986	0.895	cell surface
GO:0030659	0.856	cytoplasmic vesicle membrane
GO:0098588	0.845	bounding membrane of organelle
GO:0030141	0.816	secretory granule
GO:0005576	0.791	extracellular region
GO:0005615	0.637	extracellular space
GO:0030667	0.579	secretory granule membrane
GO:0098552	0.528	side of membrane
GO:0070062	0.339	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]