StarFunc result for job id O75027

User Input

>input (752 residues)
MALLAMHSWRWAAAAAAFEKRRHSAILIRPLVSVSGSGPQWRPHQLGALGTARAYQIPES
LKSITWQRLGKGNSGQFLDAAKALQVWPLIEKRTCWHGHAGGGLHTDPKEGLKDVDTRKI
IKAMLSYVWPKDRPDLRARVAISLGFLGGAKAMNIVVPFMFKYAVDSLNQMSGNMLNLSD
APNTVATMATAVLIGYGVSRAGAAFFNEVRNAVFGKVAQNSIRRIAKNVFLHLHNLDLGF
HLSRQTGALSKAIDRGTRGISFVLSALVFNLLPIMFEVMLVSGVLYYKCGAQFALVTLGT
LGTYTAFTVAVTRWRTRFRIEMNKADNDAGNAAIDSLLNYETVKYFNNERYEAQRYDGFL
KTYETASLKSTSTLAMLNFGQSAIFSVGLTAIMVLASQGIVAGTLTVGDLVMVNGLLFQL
SLPLNFLGTVYRETRQALIDMNTLFTLLKVDTQIKDKVMASPLQITPQTATVAFDNVHFE
YIEGQKVLSGISFEVPAGKKVAIVGGSGSGKSTIVRLLFRFYEPQKGSIYLAGQNIQDVS
LESLRRAVGVVPQDAVLFHNTIYYNLLYGNISASPEEVYAVAKLAGLHDAILRMPHGYDT
QVGERGLKLSGGEKQRVAIARAILKDPPVILYDEATSSLDSITEETILGAMKDVVKHRTS
IFIAHRLSTVVDADEIIVLDQGKVAERGTHHGLLANPHSIYSEMWHTQSSRVQNHDNPKW
EAKKENISKEEERKKLQEEIVNSVKGCGNCSC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75027	1.000	1.000	0.000	752	1.000	1.000	O75027.pdb.gz	ABCB7_HUMAN Iron-sulfur clusters transporter ABCB7, mitochondrial OS=Homo sapiens OX=9606 GN=ABCB7 PE=1 SV=2
2	AFDB:H2LNR5	0.835	0.841	1.097E-83	746	0.725	0.731	H2LNR5.pdb.gz	ABCB7_ORYLA Iron-sulfur clusters transporter ABCB7, mitochondrial OS=Oryzias latipes OX=8090 GN=abcb7 PE=1 SV=2
3	AFDB:E7F6F7	0.823	0.833	3.110E-83	743	0.729	0.738	E7F6F7.pdb.gz	ABCB7_DANRE Iron-sulfur clusters transporter ABCB7, mitochondrial OS=Danio rerio OX=7955 GN=abcb7 PE=3 SV=1
4	PDB:7vgfA	0.687	0.928	2.172E-64	550	0.730	0.998	7vgfA.pdb.gz	Cryo-EM structure of AMP-PNP-bound human mitochondrial ATP-binding cassette transporter ABCB7.
5	AFDB:G4SRS5	0.777	0.829	6.776E-63	704	0.461	0.493	G4SRS5.pdb.gz	G4SRS5_CAEEL ABC transmembrane type-1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=abtm-1 PE=1 SV=1
6	AFDB:Q9LVM1	0.766	0.791	9.439E-61	728	0.459	0.474	Q9LVM1.pdb.gz	AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ABCB25 PE=1 SV=1
7	AFDB:Q9FUT3	0.787	0.870	2.352E-59	678	0.439	0.487	Q9FUT3.pdb.gz	AB23B_ARATH ABC transporter B family member 23, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ABCB23 PE=1 SV=1
8	AFDB:Q9M0G9	0.781	0.861	6.089E-59	680	0.438	0.484	Q9M0G9.pdb.gz	AB24B_ARATH ABC transporter B family member 24, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ABCB24 PE=1 SV=1
9	AFDB:J9VWU3	0.778	0.799	1.201E-58	732	0.431	0.443	J9VWU3.pdb.gz	ATM1_CRYNH Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=ATM1 PE=2 SV=1
10	AFDB:P40416	0.771	0.839	5.154E-57	690	0.408	0.445	P40416.pdb.gz	ATM1_YEAST Iron-sulfur clusters transporter ATM1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATM1 PE=1 SV=2
11	AFDB:O14286	0.774	0.839	5.642E-57	693	0.402	0.436	O14286.pdb.gz	ATM1_SCHPO Iron-sulfur clusters transporter atm1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atm1 PE=3 SV=2
12	PDB:7n58A	0.712	0.881	1.386E-51	600	0.445	0.558	7n58A.pdb.gz
13	PDB:7d7nA	0.712	0.758	2.703E-40	704	0.330	0.352	7d7nA.pdb.gz
14	PDB:7ph3A	0.633	0.803	1.307E-34	577	0.230	0.300	7ph3A.pdb.gz	The ABC transporter MsbA adopts the wide inward-open conformation in E. coli cells.
15	PDB:5mkkA	0.664	0.823	9.590E-34	593	0.230	0.292	5mkkA.pdb.gz
16	PDB:5mkkB	0.628	0.796	1.317E-33	577	0.218	0.284	5mkkB.pdb.gz
17	PDB:4q4aA	0.619	0.787	3.257E-33	572	0.188	0.247	4q4aA.pdb.gz	Structural basis for allosteric cross-talk between the asymmetric nucleotide binding sites of a heterodimeric ABC exporter.
18	PDB:3qf4B	0.636	0.791	3.759E-32	588	0.210	0.269	3qf4B.pdb.gz	Crystal structure of a heterodimeric ABC transporter in its inward-facing conformation
19	PDB:4m1mA	0.633	0.418	2.334E-29	1188	0.214	0.136	4m1mA.pdb.gz	Refined structures of mouse P-glycoprotein.
20	PDB:7t55A	0.660	0.691	3.508E-29	715	0.219	0.231	7t55A.pdb.gz	Structures of the peptidase-containing ABC transporter PCAT1 under equilibrium and nonequilibrium conditions.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7F6F7	0.0	1139	743	0.729	0.738	ABCB7_DANRE Iron-sulfur clusters transporter ABCB7, mitochondrial OS=Danio rerio OX=7955 GN=abcb7 PE=3 SV=1
2	G4SRS5	0.0	722	704	0.488	0.521	G4SRS5_CAEEL ABC transmembrane type-1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=abtm-1 PE=1 SV=1
3	H2LNR5	0.0	1134	746	0.718	0.724	ABCB7_ORYLA Iron-sulfur clusters transporter ABCB7, mitochondrial OS=Oryzias latipes OX=8090 GN=abcb7 PE=1 SV=2
4	J9VWU3	0.0	623	732	0.412	0.423	ATM1_CRYNH Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=ATM1 PE=2 SV=1
5	O14286	0.0	602	693	0.395	0.429	ATM1_SCHPO Iron-sulfur clusters transporter atm1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atm1 PE=3 SV=2
6	O75027	0.0	1555	752	1.000	1.000	ABCB7_HUMAN Iron-sulfur clusters transporter ABCB7, mitochondrial OS=Homo sapiens OX=9606 GN=ABCB7 PE=1 SV=2
7	P40416	0.0	602	690	0.396	0.432	ATM1_YEAST Iron-sulfur clusters transporter ATM1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATM1 PE=1 SV=2
8	Q61102	0.0	1436	752	0.923	0.923	ABCB7_MOUSE Iron-sulfur clusters transporter ABCB7, mitochondrial OS=Mus musculus OX=10090 GN=Abcb7 PE=1 SV=3
9	Q704E8	0.0	1440	752	0.926	0.926	ABCB7_RAT Iron-sulfur clusters transporter ABCB7, mitochondrial OS=Rattus norvegicus OX=10116 GN=Abcb7 PE=1 SV=1
10	Q8T9W2	0.0	634	697	0.408	0.440	ABCB5_DICDI ABC transporter B family member 5 OS=Dictyostelium discoideum OX=44689 GN=abcB5 PE=3 SV=1
11	Q9FUT3	0.0	670	678	0.434	0.481	AB23B_ARATH ABC transporter B family member 23, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ABCB23 PE=1 SV=1
12	Q9LVM1	0.0	690	728	0.453	0.468	AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ABCB25 PE=1 SV=1
13	Q9M0G9	0.0	656	680	0.427	0.472	AB24B_ARATH ABC transporter B family member 24, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ABCB24 PE=1 SV=1
14	O70595	3.69e-157	479	836	0.342	0.307	ABCB6_RAT ATP-binding cassette sub-family B member 6 OS=Rattus norvegicus OX=10116 GN=Abcb6 PE=1 SV=1
15	Q9NP58	1.56e-156	477	842	0.340	0.304	ABCB6_HUMAN ATP-binding cassette sub-family B member 6 OS=Homo sapiens OX=9606 GN=ABCB6 PE=1 SV=1
16	Q380Z4	1.50e-155	471	719	0.335	0.350	Q380Z4_TRYB2 ABC transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8700 PE=4 SV=1
17	Q9DC29	6.27e-155	473	842	0.347	0.310	ABCB6_MOUSE ATP-binding cassette sub-family B member 6 OS=Mus musculus OX=10090 GN=Abcb6 PE=1 SV=1
18	Q9VF20	1.63e-152	468	866	0.339	0.294	Q9VF20_DROME ATP-binding cassette sub-family B member 6 OS=Drosophila melanogaster OX=7227 GN=Hmt-1 PE=1 SV=1
19	F1QCK2	4.48e-150	461	851	0.375	0.331	F1QCK2_DANRE ATP-binding cassette sub-family B member 6 OS=Danio rerio OX=7955 GN=abcb6 PE=1 SV=1
20	G5EFD4	2.16e-147	452	801	0.324	0.305	HMT1_CAEEL Heavy metal tolerance factor 1 OS=Caenorhabditis elegans OX=6239 GN=hmt-1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	3.3	19.5	AAA ATPase domain
2	PF13401 AAA_22	2.6e+02	13.3	AAA domain
3	PF13476 AAA_23	6.2e+02	12.3	AAA domain
4	PF13521 AAA_28	3.7e+02	12.7	AAA domain
5	PF13555 AAA_29	38	15.5	P-loop containing region of AAA domain
6	PF00664 ABC_membrane	2.9e-33	127.3	ABC transporter transmembrane region
7	PF00005 ABC_tran	3.5e-30	116.7	ABC transporter
8	PF05128 DUF697	8.3e+02	11.1	Domain of unknown function (DUF697)
9	PF01935 DUF87	43	15.6	Helicase HerA, central domain
10	PF02463 SMC_N	0.1	23.6	RecF/RecN/SMC N terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000253577

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000372326	0.993	Ferrochelatase, mitochondrial
2	9606.ENSP00000283027	0.989	Cytosolic Fe-S cluster assembly factor NUBP1
3	9606.ENSP00000262302	0.972	Cytosolic Fe-S cluster assembly factor NUBP2
4	9606.ENSP00000328570	0.901	Glutaredoxin-related protein 5, mitochondrial
5	9606.ENSP00000216027	0.899	Iron-sulfur cluster co-chaperone protein HscB, mitochondrial
6	9606.ENSP00000366482	0.885	Frataxin, mitochondrial
7	9606.ENSP00000363205	0.879	Cysteine desulfurase, mitochondrial
8	9606.ENSP00000310623	0.872	Iron-sulfur cluster assembly enzyme ISCU, mitochondrial
9	9606.ENSP00000365159	0.870	Iron-sulfur cluster assembly 1 homolog, mitochondrial
10	9606.ENSP00000387219	0.858	NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
11	9606.ENSP00000429200	0.847	Mitoferrin-1
12	9606.ENSP00000360576	0.844	NADPH-dependent diflavin oxidoreductase 1
13	9606.ENSP00000251588	0.840	Cytosolic Fe-S cluster assembly factor NARFL
14	9606.ENSP00000420026	0.837	LYR motif-containing protein 4
15	9606.ENSP00000273158	0.835	Solute carrier family 25 member 38
16	9606.ENSP00000452007	0.832	Iron-sulfur cluster assembly 2 homolog, mitochondrial
17	9606.ENSP00000377914	0.828	Anamorsin
18	9606.ENSP00000355672	0.824	Putative transferase CAF17, mitochondrial
19	9606.ENSP00000332369	0.815	5-aminolevulinate synthase, erythroid-specific, mitochondrial
20	9606.ENSP00000418287	0.793	Probable cytosolic iron-sulfur protein assembly protein CIAO1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0022857	0.999	transmembrane transporter activity
GO:0005515	0.999	protein binding
GO:0042626	0.966	ATPase-coupled transmembrane transporter activity
GO:0097159	0.681	organic cyclic compound binding
GO:1901363	0.679	heterocyclic compound binding
GO:0042802	0.565	identical protein binding
GO:0140359	0.545	ABC-type transporter activity
GO:0003824	0.375	catalytic activity
GO:0043167	0.357	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019725	0.991	cellular homeostasis
GO:0009987	0.984	cellular process
GO:0055072	0.978	iron ion homeostasis
GO:0006879	0.956	intracellular iron ion homeostasis
GO:0065007	0.835	biological regulation
GO:0008152	0.823	metabolic process
GO:0050789	0.810	regulation of biological process
GO:0050794	0.800	regulation of cellular process
GO:0019222	0.725	regulation of metabolic process
GO:0044237	0.698	cellular metabolic process
GO:0031323	0.651	regulation of cellular metabolic process
GO:0071840	0.450	cellular component organization or biogenesis
GO:0016043	0.405	cellular component organization
GO:0051179	0.391	localization
GO:0071704	0.328	organic substance metabolic process
GO:0006810	0.319	transport
GO:0050896	0.309	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005739	1.000	mitochondrion
GO:0031090	0.993	organelle membrane
GO:0031975	0.990	envelope
GO:0031967	0.982	organelle envelope
GO:0005740	0.917	mitochondrial envelope
GO:0031966	0.914	mitochondrial membrane
GO:0019866	0.812	organelle inner membrane
GO:0005743	0.797	mitochondrial inner membrane
GO:0070013	0.382	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.966	Translocases.

[back to server]