StarFunc result for job id O75037

User Input

>input (1637 residues)
MAGQGDCCVKVAVRIRPQLSKEKIEGCHICTSVTPGEPQVLLGKDKAFTYDFVFDLDTWQ
EQIYSTCVSKLIEGCFEGYNATVLAYGQTGAGKTYTMGTGFDMATSEEEQGIIPRAIAHL
FGGIAERKRRAQEQGVAGPEFKVSAQFLELYNEEILDLFDSTRDPDTRHRRSNIKIHEDA
NGGIYTTGVTSRLIHSQEELIQCLKQGALSRTTASTQMNVQSSRSHAIFTIHLCQMRMCT
QPDLVNEAVTGLPDGTPPSSEYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGL
LALGNVISALGDQSKKVVHVPYRDSKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLNT
LKYANRARNIKNKVVVNQDKTSQQISALRAEIARLQMELMEYKAGKRVIGEDGAEGYSDL
FRENAMLQKENGALRLRVKAMQEAIDAINNRVTQLMSQEANLLLAKAGDGNEAIGALIQN
YIREIEELRTKLLESEAMNESLRRSLSRASARSPYSLGASPAAPAFGGSPASSMEDASEV
IRRAKQDLERLKKKEVRQRRKSPEKEAFKKRAKLQQENSEETDENEAEEEEEERDESGCE
EEEGREDEDEDSGSEESLVDSDSDPEEKEVNFQADLADLTCEIEIKQKLIDELENSQRRL
QTLKHQYEEKLILLQNKIRDTQLERDRVLQNLSTMECYTEEKANKIKADYEKRLREMNRD
LQKLQAAQKEHARLLKNQSRYERELKKLQAEVAEMKKAKVALMKQMREEQQRRRLVETKR
NREIAQLKKEQRRQEFQIRALESQKRQQEMVLRRKTQEVSALRRLAKPMSERVAGRAGLK
PPMLDSGAEVSASTTSSEAESGARSVSSIVRQWNRKINHFLGDHPAPTVNGTRPARKKFQ
KKGASQSFSKAARLKWQSLERRIIDIVMQRMTIVNLEADMERLIKKREELFLLQEALRRK
RERLQAESPEEEKGLQELAEEIEVLAANIDYINDGITDCQATIVQLEETKEELDSTDTSV
VISSCSLAEARLLLDNFLKASIDKGLQVAQKEAQIRLLEGRLRQTDMAGSSQNHLLLDAL
REKAEAHPELQALIYNVQQENGYASTDEEISEFSEGSFSQSFTMKGSTSHDDFKFKSEPK
LSAQMKAVSAECLGPPLDISTKNITKSLASLVEIKEDGVGFSVRDPYYRDRVSRTVSLPT
RGSTFPRQSRATETSPLTRRKSYDRGQPIRSTDVGFTPPSSPPTRPRNDRNVFSRLTSNQ
SQGSALDKSDDSDSSLSEVLRGIISPVGGAKGARTAPLQCVSMAEGHTKPILCLDATDEL
LFTGSKDRSCKMWNLVTGQEIAALKGHPNNVVSIKYCSHSGLVFSVSTSYIKVWDIRDSA
KCIRTLTSSGQVISGDACAATSTRAITSAQGEHQINQIALSPSGTMLYAASGNAVRIWEL
SRFQPVGKLTGHIGPVMCLTVTQTASQHDLVVTGSKDHYVKMFELGECVTGTIGPTHNFE
PPHYDGIECLAIQGDILFSGSRDNGIKKWDLDQQELIQQIPNAHKDWVCALAFIPGRPML
LSACRAGVIKVWNVDNFTPIGEIKGHDSPINAICTNAKHIFTASSDCRVKLWNYVPGLTP
CLPRRVLAIKGRATTLP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z4S6	0.301	0.296	0.000	1674	0.604	0.591	Q7Z4S6.pdb.gz	KI21A_HUMAN Kinesin-like protein KIF21A OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=2
2	AFDB:Q9QXL1	0.275	0.271	0.000	1668	0.962	0.944	Q9QXL1.pdb.gz	KI21B_MOUSE Kinesin-like protein KIF21B OS=Mus musculus OX=10090 GN=Kif21b PE=1 SV=2
3	AFDB:Q86VH2	0.216	0.252	7.467E-51	1401	0.214	0.250	Q86VH2.pdb.gz	KIF27_HUMAN Kinesin-like protein KIF27 OS=Homo sapiens OX=9606 GN=KIF27 PE=1 SV=1
4	AFDB:Q7M6Z4	0.212	0.247	1.534E-49	1394	0.213	0.250	Q7M6Z4.pdb.gz	KIF27_MOUSE Kinesin-like protein KIF27 OS=Mus musculus OX=10090 GN=Kif27 PE=1 SV=1
5	AFDB:O45935	0.212	0.316	1.735E-42	1083	0.180	0.271	O45935.pdb.gz	KLP19_CAEEL Kinesin-like protein klp-19 OS=Caenorhabditis elegans OX=6239 GN=klp-19 PE=2 SV=1
6	AFDB:Q8NI77	0.196	0.352	1.130E-31	898	0.142	0.259	Q8NI77.pdb.gz	KI18A_HUMAN Kinesin-like protein KIF18A OS=Homo sapiens OX=9606 GN=KIF18A PE=1 SV=2
7	AFDB:Q57V47	0.201	0.534	1.708E-30	591	0.082	0.228	Q57V47.pdb.gz	Q57V47_TRYB2 Kinesin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.3K10.480 PE=3 SV=1
8	AFDB:Q91WD7	0.202	0.362	1.892E-30	886	0.123	0.228	Q91WD7.pdb.gz	KI18A_MOUSE Kinesin-like protein KIF18A OS=Mus musculus OX=10090 GN=Kif18a PE=2 SV=1
9	AFDB:Q86Y91	0.194	0.364	4.521E-30	852	0.140	0.269	Q86Y91.pdb.gz	KI18B_HUMAN Kinesin-like protein KIF18B OS=Homo sapiens OX=9606 GN=KIF18B PE=1 SV=4
10	AFDB:Q57V46	0.205	0.546	4.759E-30	578	0.087	0.247	Q57V46.pdb.gz	Q57V46_TRYB2 Kinesin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.3K10.490 PE=3 SV=1
11	PDB:7wrgA	0.191	0.377	7.549E-28	812	0.086	0.172	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
12	PDB:7wrgB	0.186	0.380	1.478E-25	783	0.089	0.185	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
13	PDB:5mzhB	0.161	0.572	5.667E-21	415	0.045	0.178	5mzhB.pdb.gz
14	PDB:4h1gA	0.165	0.388	1.286E-20	670	0.067	0.163	4h1gA.pdb.gz	Crystal structure of the Candida albicans Kar3 kinesin motor domain fused to maltose-binding protein.
15	PDB:7jvrB	0.164	0.743	1.358E-19	342	0.035	0.167	7jvrB.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
16	PDB:6bk8D	0.168	0.724	3.082E-19	359	0.047	0.214	6bk8D.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
17	PDB:5nnzA	0.161	0.687	4.412E-19	335	0.043	0.212	5nnzA.pdb.gz
18	PDB:7bt6x	0.166	0.506	1.002E-18	488	0.046	0.154	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
19	PDB:1vyhC	0.163	0.814	1.054E-18	310	0.045	0.239	1vyhC.pdb.gz
20	PDB:7qdrC	0.164	0.818	2.052E-18	305	0.038	0.203	7qdrC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1B0GV47	0.0	1907	1653	0.600	0.595	A0A1B0GV47_HUMAN Kinesin family member 21A (Fragment) OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=1
2	H0YHT2	0.0	1072	975	0.335	0.563	H0YHT2_HUMAN Kinesin family member 21A (Fragment) OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=1
3	H0YI78	0.0	723	655	0.219	0.547	H0YI78_HUMAN Kinesin family member 21A (Fragment) OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=1
4	O75037	0.0	3388	1637	1.000	1.000	KI21B_HUMAN Kinesin-like protein KIF21B OS=Homo sapiens OX=9606 GN=KIF21B PE=1 SV=2
5	Q7Z4S6	0.0	1912	1674	0.604	0.590	KI21A_HUMAN Kinesin-like protein KIF21A OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=2
6	Q9QXL1	0.0	3266	1668	0.963	0.945	KI21B_MOUSE Kinesin-like protein KIF21B OS=Mus musculus OX=10090 GN=Kif21b PE=1 SV=2
7	A0A068FIK2	1.83e-113	387	1033	0.129	0.204	KN4A_GOSHI Kinesin-like protein KIN-4A OS=Gossypium hirsutum OX=3635 GN=KIN4A PE=2 SV=1
8	Q6YUL8	2.53e-110	379	1035	0.127	0.201	KN4A_ORYSJ Kinesin-like protein KIN-4A OS=Oryza sativa subsp. japonica OX=39947 GN=KIN4A PE=1 SV=1
9	F4K0J3	1.51e-109	382	1300	0.178	0.225	KN4C_ARATH Kinesin-like protein KIN-4C OS=Arabidopsis thaliana OX=3702 GN=KIN4C PE=2 SV=2
10	O95239	1.65e-108	378	1232	0.122	0.162	KIF4A_HUMAN Chromosome-associated kinesin KIF4A OS=Homo sapiens OX=9606 GN=KIF4A PE=1 SV=3
11	P33174	2.16e-108	377	1231	0.121	0.161	KIF4_MOUSE Chromosome-associated kinesin KIF4 OS=Mus musculus OX=10090 GN=Kif4 PE=1 SV=3
12	Q8GS71	3.75e-108	372	1035	0.125	0.197	KN4A_ARATH Kinesin-like protein KIN-4A OS=Arabidopsis thaliana OX=3702 GN=KIN4A PE=1 SV=1
13	Q2VIQ3	1.16e-104	366	1234	0.128	0.169	KIF4B_HUMAN Chromosome-associated kinesin KIF4B OS=Homo sapiens OX=9606 GN=KIF4B PE=2 SV=2
14	Q86VH2	1.54e-103	366	1401	0.117	0.137	KIF27_HUMAN Kinesin-like protein KIF27 OS=Homo sapiens OX=9606 GN=KIF27 PE=1 SV=1
15	Q7M6Z4	1.65e-99	353	1394	0.110	0.129	KIF27_MOUSE Kinesin-like protein KIF27 OS=Mus musculus OX=10090 GN=Kif27 PE=1 SV=1
16	Q58G59	2.04e-92	332	1363	0.109	0.131	KIF7_DANRE Kinesin-like protein kif7 OS=Danio rerio OX=7955 GN=kif7 PE=1 SV=1
17	Q2M1P5	2.48e-92	331	1343	0.108	0.131	KIF7_HUMAN Kinesin-like protein KIF7 OS=Homo sapiens OX=9606 GN=KIF7 PE=1 SV=2
18	B7ZNG0	3.66e-92	331	1348	0.109	0.132	KIF7_MOUSE Kinesin-like protein KIF7 OS=Mus musculus OX=10090 GN=Kif7 PE=1 SV=1
19	Q9XZ29	5.37e-90	322	1212	0.110	0.149	Q9XZ29_DROME EG:BACR25B3.9 protein OS=Drosophila melanogaster OX=7227 GN=Klp3A PE=1 SV=1
20	P46873	2.41e-82	288	699	0.103	0.240	OSM3_CAEEL Osmotic avoidance abnormal protein 3 OS=Caenorhabditis elegans OX=6239 GN=osm-3 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	3.1e+02	13.1	Anaphase-promoting complex subunit 4 WD40 domain
2	PF13334 DUF4094	4e+02	12.9	Domain of unknown function (DUF4094)
3	PF16888 DUF5082	3.5e+02	12.9	Domain of unknown function (DUF5082)
4	PF00225 Kinesin	7e-101	349.1	Kinesin motor domain
5	PF16796 Microtub_bd	7.7e-16	69.9	Microtubule binding
6	PF20426 NBCH_WD40	0.46	20.9	Neurobeachin beta propeller domain
7	PF00400 WD40	2e-25	99.7	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000411831

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260731	0.763	Kinesin-like protein KIF11
2	9606.ENSP00000326063	0.741	Transmembrane protein 39A
3	9606.ENSP00000433102	0.740	Tripartite motif-containing protein 3
4	9606.ENSP00000354560	0.732	Kinesin-associated protein 3
5	9606.ENSP00000404190	0.696	Rac GTPase-activating protein 1
6	9606.ENSP00000408979	0.685	Kinesin heavy chain isoform 5A
7	9606.ENSP00000484715	0.683	SRC kinase signaling inhibitor 1
8	9606.ENSP00000307078	0.670	Kinesin-1 heavy chain
9	9606.ENSP00000359664	0.660	Di-N-acetylchitobiase
10	9606.ENSP00000371846	0.655	Deformed epidermal autoregulatory factor 1 homolog
11	9606.ENSP00000269878	0.646	Calcium and integrin binding family member 3
12	9606.ENSP00000378725	0.632	Kinectin
13	9606.ENSP00000281474	0.626	Protein bicaudal D homolog 1
14	9606.ENSP00000387875	0.617	Chromosome-associated kinesin KIF4B
15	9606.ENSP00000265148	0.614	Centromere-associated protein E
16	9606.ENSP00000255882	0.613	Phosphatidylinositol 4-kinase alpha
17	9606.ENSP00000378356	0.612	Kinesin-like protein KIF20A
18	9606.ENSP00000260363	0.611	Kinesin-like protein KIF23
19	9606.ENSP00000363524	0.611	Chromosome-associated kinesin KIF4A
20	9606.ENSP00000336994	0.599	Cleft lip and palate transmembrane protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003774	0.825	cytoskeletal motor activity
GO:0003777	0.541	microtubule motor activity
GO:0015631	0.468	tubulin binding
GO:0008017	0.462	microtubule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.919	cellular process
GO:0032501	0.846	multicellular organismal process
GO:0065007	0.813	biological regulation
GO:0050789	0.785	regulation of biological process
GO:0050794	0.753	regulation of cellular process
GO:0048856	0.678	anatomical structure development
GO:0007275	0.589	multicellular organism development
GO:0071840	0.568	cellular component organization or biogenesis
GO:0016043	0.543	cellular component organization
GO:0048513	0.531	animal organ development
GO:0060322	0.530	head development
GO:0007417	0.493	central nervous system development
GO:0007017	0.479	microtubule-based process
GO:0030900	0.439	forebrain development
GO:0006996	0.436	organelle organization
GO:0021537	0.419	telencephalon development
GO:0051179	0.357	localization
GO:0051234	0.312	establishment of localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.997	membrane
GO:0005829	0.997	cytosol
GO:0043227	0.979	membrane-bounded organelle
GO:0032991	0.962	protein-containing complex
GO:0043232	0.962	intracellular non-membrane-bounded organelle
GO:0005856	0.934	cytoskeleton
GO:0071944	0.840	cell periphery
GO:0043231	0.821	intracellular membrane-bounded organelle
GO:0005886	0.651	plasma membrane
GO:0015630	0.628	microtubule cytoskeleton
GO:0005634	0.553	nucleus
GO:0070013	0.407	intracellular organelle lumen
GO:0005654	0.386	nucleoplasm
GO:0042995	0.305	cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]