StarFunc result for job id O75038

User Input

>input (1416 residues)
MSGPWPSPDSRTKGTVAWLAEVLLWVGGSVVLSSEWQLGPLVERCMGAMQEGMQMVKLRG
GSKGLVRFYYLDEHRSCIRWRPSRKNEKAKISIDSIQEVSEGRQSEVFQRYPDGSFDPNC
CFSIYHGSHRESLDLVSTSSEVARTWVTGLRYLMAGISDEDSLARRQRTRDQWLKQTFDE
ADKNGDGSLSIGEVLQLLHKLNVNLPRQRVKQMFREADTDDHQGTLGFEEFCAFYKMMST
RRDLYLLMLTYSNHKDHLDAASLQRFLQVEQKMAGVTLESCQDIIEQFEPCPENKSKGLL
GIDGFTNYTRSPAGDIFNPEHHHVHQDMTQPLSHYFITSSHNTYLVGDQLMSQSRVDMYA
WVLQAGCRCVEVDCWDGPDGEPIVHHGYTLTSKILFKDVIETINKYAFIKNEYPVILSIE
NHCSVIQQKKMAQYLTDILGDKLDLSSVSSEDATTLPSPQMLKGKILVKGKKLPANISED
AEEGEVSDEDSADEIDDDCKLLNGDASTNRKRVENTAKRKLDSLIKESKIRDCEDPNNFS
VSTLSPSGKLGRKSKAEEDVESGEDAGASRRNGRLVVGSFSRRKKKGSKLKKAASVEEGD
EGQDSPGGQSRGATRQKKTMKLSRALSDLVKYTKSVATHDIEMEAASSWQVSSFSETKAH
QILQQKPAQYLRFNQQQLSRIYPSSYRVDSSNYNPQPFWNAGCQMVALNYQSEGRMLQLN
RAKFSANGGCGYVLKPGCMCQGVFNPNSEDPLPGQLKKQLVLRIISGQQLPKPRDSMLGD
RGEIIDPFVEVEIIGLPVDCSREQTRVVDDNGFNPTWEETLVFMVHMPEIALVRFLVWDH
DPIGRDFIGQRTLAFSSMMPGYRHVYLEGMEEASIFVHVAVSDISGKVKQALGLKGLFLR
GPKPGSLDSHAAGRPPARPSVSQRILRRTASAPTKSQKPGRRGFPELVLGTRDTGSKGVA
DDVVPPGPGPAPEAPAQEGPGSGSPRDTRPLSTQRPLPPLCSLETIAEEPAPGPGPPPPA
AVPTSSSQGRPPYPTGPGANVASPLEDTEEPRDSRPRPCNGEGAGGAYERAPGSQTDGRS
QPRTLGHLPVIRRVKSEGQVPTEPLGGWRPLAAPFPAPAVYSDATGSDPLWQRLEPCGHR
DSVSSSSSMSSSDTVIDLSLPSLGLGRSRENLAGAHMGRLPPRPHSASAARPDLPPVTKS
KSNPNLRATGQRPPIPDELQPRSLAPRMAGLPFRPPWGCLSLVGVQDCPVAAKSKSLGDL
TADDFAPSFEGGSRRLSHSLGLPGGTRRVSGPGVRRDTLTEQLRWLTVFQQAGDITSPTS
LGPAGEGVAGGPGFVRRSSSRSHSRVRAIASRARQAQERQQRLQGLGRQGPPEEERGTPE
GACSVGHEGSVDAPAPSKGALGPASAAAENLVLLRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2AP18	0.734	0.696	0.000	1501	0.830	0.783	A2AP18.pdb.gz	PLCH2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Mus musculus OX=10090 GN=Plch2 PE=1 SV=2
2	AFDB:O75038	1.000	1.000	0.000	1416	1.000	1.000	O75038.pdb.gz	PLCH2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Homo sapiens OX=9606 GN=PLCH2 PE=1 SV=3
3	AFDB:Q4KWH5	0.565	0.479	0.000	1682	0.499	0.420	Q4KWH5.pdb.gz	PLCH1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Mus musculus OX=10090 GN=Plch1 PE=2 SV=1
4	AFDB:Q8K394	0.385	0.480	6.300E-79	1128	0.231	0.290	Q8K394.pdb.gz	PLCL2_MOUSE Inactive phospholipase C-like protein 2 OS=Mus musculus OX=10090 GN=Plcl2 PE=1 SV=2
5	AFDB:P10688	0.466	0.844	2.295E-74	756	0.207	0.388	P10688.pdb.gz	PLCD1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Rattus norvegicus OX=10116 GN=Plcd1 PE=1 SV=1
6	AFDB:Q8K2J0	0.457	0.802	2.860E-73	785	0.214	0.386	Q8K2J0.pdb.gz	PLCD3_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Mus musculus OX=10090 GN=Plcd3 PE=1 SV=2
7	AFDB:H2LIC9	0.349	0.730	1.925E-61	659	0.173	0.372	H2LIC9.pdb.gz	H2LIC9_ORYLA Phosphoinositide phospholipase C OS=Oryzias latipes OX=8090 GN=PLCZ1 PE=4 SV=2
8	AFDB:Q8K4D7	0.370	0.778	5.195E-60	647	0.169	0.371	Q8K4D7.pdb.gz	PLCZ1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Mus musculus OX=10090 GN=Plcz1 PE=1 SV=1
9	AFDB:Q86YW0	0.365	0.819	9.635E-60	608	0.168	0.391	Q86YW0.pdb.gz	PLCZ1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Homo sapiens OX=9606 GN=PLCZ1 PE=1 SV=1
10	AFDB:Q5FX52	0.365	0.772	4.288E-59	645	0.167	0.366	Q5FX52.pdb.gz	PLCZ1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Rattus norvegicus OX=10116 GN=Plcz1 PE=2 SV=1
11	PDB:4gnkB	0.414	0.728	1.942E-53	769	0.167	0.307	4gnkB.pdb.gz	Full-length G alpha (q)-phospholipase C-beta 3 structure reveals interfaces of the C-terminal coiled-coil domain.
12	PDB:1cjyA	0.084	0.181	8.842E-8	633	0.020	0.044	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
13	PDB:5ixcA	0.077	0.154	1.354E-6	684	0.016	0.032	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
14	PDB:5izrC	0.075	0.157	1.664E-6	659	0.016	0.035	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
15	PDB:5a50A	0.076	0.570	3.086E-6	165	0.023	0.194	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
16	PDB:5iz5A	0.076	0.140	3.249E-6	757	0.017	0.032	5iz5A.pdb.gz
17	PDB:4rj9A	0.078	0.591	3.601E-6	161	0.023	0.205	4rj9A.pdb.gz
18	PDB:5iz5B	0.080	0.149	3.791E-6	746	0.016	0.029	5iz5B.pdb.gz
19	PDB:3qrxA	0.059	0.422	1.522E-5	145	0.020	0.193	3qrxA.pdb.gz	The structure, molecular dynamics, and energetics of centrin-melittin complex.
20	PDB:5d43A	0.059	0.421	1.969E-5	150	0.018	0.173	5d43A.pdb.gz	Crystal Structure of Wild-Type Centrin 1 from Mus musculus Occupied by Ca2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2U3TZV8	0.0	1245	1685	0.424	0.356	A0A2U3TZV8_HUMAN Phosphoinositide phospholipase C OS=Homo sapiens OX=9606 GN=PLCH1 PE=1 SV=1
2	A2AP18	0.0	2283	1501	0.831	0.783	PLCH2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Mus musculus OX=10090 GN=Plch2 PE=1 SV=2
3	O75038	0.0	2906	1416	1.000	1.000	PLCH2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Homo sapiens OX=9606 GN=PLCH2 PE=1 SV=3
4	Q4KWH5	0.0	1235	1682	0.420	0.354	PLCH1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Mus musculus OX=10090 GN=Plch1 PE=2 SV=1
5	Q4KWH8	0.0	1234	1693	0.424	0.354	PLCH1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Homo sapiens OX=9606 GN=PLCH1 PE=1 SV=1
6	Q8K394	6.62e-118	399	1128	0.145	0.183	PLCL2_MOUSE Inactive phospholipase C-like protein 2 OS=Mus musculus OX=10090 GN=Plcl2 PE=1 SV=2
7	Q9UPR0	1.60e-116	395	1127	0.145	0.183	PLCL2_HUMAN Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2 PE=1 SV=2
8	A2AT91	4.72e-105	357	883	0.179	0.287	A2AT91_MOUSE Phosphoinositide phospholipase C (Fragment) OS=Mus musculus OX=10090 GN=Plcb4 PE=1 SV=1
9	V9GXQ9	2.52e-104	359	1022	0.176	0.244	V9GXQ9_MOUSE Phosphoinositide phospholipase C OS=Mus musculus OX=10090 GN=Plcb4 PE=1 SV=1
10	Q5FWA6	7.72e-104	354	892	0.178	0.283	Q5FWA6_MOUSE Phosphoinositide phospholipase C (Fragment) OS=Mus musculus OX=10090 GN=Plcb4 PE=2 SV=1
11	Q15147	2.19e-102	356	1175	0.176	0.212	PLCB4_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 OS=Homo sapiens OX=9606 GN=PLCB4 PE=1 SV=3
12	Q3USB7	5.31e-102	354	1096	0.140	0.181	PLCL1_MOUSE Inactive phospholipase C-like protein 1 OS=Mus musculus OX=10090 GN=Plcl1 PE=1 SV=3
13	Q62688	1.79e-101	352	1096	0.144	0.186	PLCL1_RAT Inactive phospholipase C-like protein 1 OS=Rattus norvegicus OX=10116 GN=Plcl1 PE=1 SV=1
14	Q15111	1.04e-100	350	1095	0.138	0.179	PLCL1_HUMAN Inactive phospholipase C-like protein 1 OS=Homo sapiens OX=9606 GN=PLCL1 PE=1 SV=3
15	Q9BRC7	5.76e-99	337	762	0.132	0.245	PLCD4_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Homo sapiens OX=9606 GN=PLCD4 PE=1 SV=1
16	C9JEA7	6.71e-99	338	794	0.132	0.236	C9JEA7_HUMAN Phosphoinositide phospholipase C OS=Homo sapiens OX=9606 GN=PLCD4 PE=1 SV=1
17	Q91UZ1	2.46e-97	342	1175	0.175	0.211	Q91UZ1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Mus musculus OX=10090 GN=Plcb4 PE=1 SV=1
18	Q9QW07	3.33e-97	342	1175	0.174	0.210	PLCB4_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 OS=Rattus norvegicus OX=10116 GN=Plcb4 PE=1 SV=2
19	F1Q5G9	8.41e-95	325	761	0.127	0.237	F1Q5G9_DANRE Phosphoinositide phospholipase C OS=Danio rerio OX=7955 GN=plcd4a PE=4 SV=1
20	Q8K3R3	2.44e-93	322	807	0.126	0.222	PLCD4_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Mus musculus OX=10090 GN=Plcd4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12848 ABC_tran_Xtn	2.5e+02	13.1	ABC transporter
2	PF00168 C2	3e-12	58.1	C2 domain
3	PF00036 EF-hand_1	6.3e-05	33.3	EF hand
4	PF14788 EF-hand_10	0.013	26.7	EF hand
5	PF12763 EF-hand_4	1.6e+02	13.7	Cytoskeletal-regulatory complex EF hand
6	PF13202 EF-hand_5	0.43	21.3	EF hand
7	PF13405 EF-hand_6	0.0023	28.7	EF-hand domain
8	PF13499 EF-hand_7	8.8e-09	47.0	EF-hand domain pair
9	PF13833 EF-hand_8	1	20.5	EF-hand domain pair
10	PF09279 EF-hand_like	6.3e-12	57.2	Phosphoinositide-specific phospholipase C, efhand-like
11	PF00169 PH	1.3	20.9	PH domain
12	PF16457 PH_12	3.9e-05	35.7	Pleckstrin homology domain
13	PF00388 PI-PLC-X	2.8e-60	213.6	Phosphatidylinositol-specific phospholipase C, X domain
14	PF00387 PI-PLC-Y	1.1e-35	133.8	Phosphatidylinositol-specific phospholipase C, Y domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367747

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000373399	0.948	Phosphatidylinositol 4-phosphate 5-kinase-like protein 1
2	9606.ENSP00000265382	0.940	Phosphatidylinositol 4-phosphate 5-kinase type-1 beta
3	9606.ENSP00000466363	0.931	Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma
4	9606.ENSP00000357883	0.930	Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha
5	9606.ENSP00000482548	0.920	Phosphatidylinositol 5-phosphate 4-kinase type-2 beta
6	9606.ENSP00000347032	0.919	Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma
7	9606.ENSP00000365757	0.919	Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha
8	9606.ENSP00000360777	0.833	72 kDa inositol polyphosphate 5-phosphatase
9	9606.ENSP00000362115	0.820	Type II inositol 1,4,5-trisphosphate 5-phosphatase
10	9606.ENSP00000347792	0.817	Synaptojanin-2
11	9606.ENSP00000409667	0.805	Synaptojanin-1
12	9606.ENSP00000357583	0.796	Type I inositol 1,4,5-trisphosphate 5-phosphatase
13	9606.ENSP00000360154	0.785	Inositol polyphosphate 5-phosphatase OCRL-1
14	9606.ENSP00000363046	0.727	Inositol polyphosphate multikinase
15	9606.ENSP00000260386	0.725	Inositol-trisphosphate 3-kinase A
16	9606.ENSP00000333262	0.710	Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A
17	9606.ENSP00000413937	0.696	Inositol polyphosphate 5-phosphatase K
18	9606.ENSP00000366563	0.695	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
19	9606.ENSP00000411152	0.690	Inositol-trisphosphate 3-kinase B
20	9606.ENSP00000263967	0.686	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004435	0.996	phosphatidylinositol phospholipase C activity
GO:0005488	0.994	binding
GO:0005515	0.964	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0050896	0.982	response to stimulus
GO:0007165	0.971	signal transduction
GO:0035556	0.956	intracellular signal transduction
GO:0044237	0.854	cellular metabolic process
GO:0071704	0.761	organic substance metabolic process
GO:0044238	0.751	primary metabolic process
GO:0048017	0.669	inositol lipid-mediated signaling
GO:0006796	0.625	phosphate-containing compound metabolic process
GO:0006629	0.558	lipid metabolic process
GO:0046488	0.530	phosphatidylinositol metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005829	0.965	cytosol
GO:0043231	0.814	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:33179	0.996	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+)
EC:3.1.4.11	0.996	phosphoinositide phospholipase C.

[back to server]