StarFunc result for job id O75044

User Input

>input (1071 residues)
MTSPAKFKKDKEIIAEYDTQVKEIRAQLTEQMKCLDQQCELRVQLLQDLQDFFRKKAEIE
MDYSRNLEKLAERFLAKTRSTKDQQFKKDQNVLSPVNCWNLLLNQVKRESRDHTTLSDIY
LNNIIPRFVQVSEDSGRLFKKSKEVGQQLQDDLMKVLNELYSVMKTYHMYNADSISAQSK
LKEAEKQEEKQIGKSVKQEDRQTPRSPDSTANVRIEEKHVRRSSVKKIEKMKEKRQAKYT
ENKLKAIKARNEYLLALEATNASVFKYYIHDLSDLIDQCCDLGYHASLNRALRTFLSAEL
NLEQSKHEGLDAIENAVENLDATSDKQRLMEMYNNVFCPPMKFEFQPHMGDMASQLCAQQ
PVQSELVQRCQQLQSRLSTLKIENEEVKKTMEATLQTIQDIVTVEDFDVSDCFQYSNSME
SVKSTVSETFMSKPSIAKRRANQQETEQFYFTKMKEYLEGRNLITKLQAKHDLLQKTLGE
SQRTDCSLARRSSTVRKQDSSQAIPLVVESCIRFISRHGLQHEGIFRVSGSQVEVNDIKN
AFERGEDPLAGDQNDHDMDSIAGVLKLYFRGLEHPLFPKDIFHDLMACVTMDNLQERALH
IRKVLLVLPKTTLIIMRYLFAFLNHLSQFSEENMMDPYNLAICFGPSLMSVPEGHDQVSC
QAHVNELIKTIIIQHENIFPSPRELEGPVYSRGGSMEDYCDSPHGETTSVEDSTQDVTAE
HHTSDDECEPIEAIAKFDYVGRTARELSFKKGASLLLYQRASDDWWEGRHNGIDGLIPHQ
YIVVQDTEDGVVERSSPKSEIEVISEPPEEKVTARAGASCPSGGHVADIYLANINKQRKR
PESGSIRKTFRSDSHGLSSSLTDSSSPGVGASCRPSSQPIMSQSLPKEGPDKCSISGHGS
LNSISRHSSLKNRLDSPQIRKTATAGRSKSFNNHRPMDPEVIAQDIEATMNSALNELREL
ERQSSVKHTPDVVLDTLEPLKTSPVVAPTSEPSSPLHTQLLKDPEPAFQRSASTAGDIAC
AFRPVKSVKMAAPVKPPATRPKPTVFPKTNATSPGVNSSTSPQSTDKSCTV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A208	0.683	0.683	0.000	1071	0.980	0.980	D4A208.pdb.gz	SRGP2_RAT SLIT-ROBO Rho GTPase-activating protein 2 OS=Rattus norvegicus OX=10116 GN=Srgap2 PE=1 SV=1
2	AFDB:Q91Z69	0.471	0.475	2.632E-97	1062	0.683	0.688	Q91Z69.pdb.gz	SRGP1_MOUSE SLIT-ROBO Rho GTPase-activating protein 1 OS=Mus musculus OX=10090 GN=Srgap1 PE=1 SV=2
3	AFDB:Q7Z6B7	0.457	0.452	5.849E-95	1085	0.683	0.674	Q7Z6B7.pdb.gz	SRGP1_HUMAN SLIT-ROBO Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=SRGAP1 PE=1 SV=1
4	AFDB:O43295	0.432	0.421	1.044E-87	1099	0.595	0.580	O43295.pdb.gz	SRGP3_HUMAN SLIT-ROBO Rho GTPase-activating protein 3 OS=Homo sapiens OX=9606 GN=SRGAP3 PE=1 SV=3
5	AFDB:A0A0G2JVF0	0.424	0.471	9.715E-57	955	0.358	0.401	A0A0G2JVF0.pdb.gz	A0A0G2JVF0_RAT Rho GTPase activating protein 4 OS=Rattus norvegicus OX=10116 GN=Arhgap4 PE=1 SV=2
6	AFDB:Q54DW4	0.160	0.128	2.017E-15	1350	0.114	0.090	Q54DW4.pdb.gz	Q54DW4_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=xacA PE=4 SV=1
7	AFDB:Q8N264	0.170	0.239	4.103E-12	748	0.096	0.138	Q8N264.pdb.gz	RHG24_HUMAN Rho GTPase-activating protein 24 OS=Homo sapiens OX=9606 GN=ARHGAP24 PE=1 SV=2
8	AFDB:Q7Z5H3	0.165	0.251	7.298E-12	698	0.107	0.165	Q7Z5H3.pdb.gz	RHG22_HUMAN Rho GTPase-activating protein 22 OS=Homo sapiens OX=9606 GN=ARHGAP22 PE=1 SV=1
9	AFDB:Q9P227	0.158	0.114	4.486E-11	1491	0.111	0.080	Q9P227.pdb.gz	RHG23_HUMAN Rho GTPase-activating protein 23 OS=Homo sapiens OX=9606 GN=ARHGAP23 PE=1 SV=2
10	AFDB:Q6DFV3	0.166	0.094	9.112E-11	1944	0.107	0.059	Q6DFV3.pdb.gz	RHG21_MOUSE Rho GTPase-activating protein 21 OS=Mus musculus OX=10090 GN=Arhgap21 PE=1 SV=2
11	PDB:3cxlA	0.157	0.407	5.285E-9	402	0.054	0.144	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
12	PDB:6r3vA	0.164	0.838	1.672E-8	198	0.048	0.258	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
13	PDB:1xa6A	0.159	0.418	3.249E-8	399	0.054	0.145	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
14	PDB:5jcpA	0.154	0.442	8.234E-8	361	0.038	0.114	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
15	PDB:5c2kA	0.151	0.410	1.028E-7	382	0.038	0.107	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
16	PDB:3hajA	0.135	0.404	7.548E-5	286	0.046	0.171	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
17	PDB:3qwyA	0.051	0.317	8.626E-4	170	0.016	0.100	3qwyA.pdb.gz
18	PDB:2dybA	0.052	0.183	2.092E-3	298	0.019	0.067	2dybA.pdb.gz
19	PDB:1k9aB	0.051	0.122	2.186E-3	441	0.016	0.039	1k9aB.pdb.gz
20	PDB:2lqnA	0.053	0.181	2.610E-3	303	0.021	0.076	2lqnA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A075B7E9	0.0	575	294	0.262	0.956	A0A075B7E9_HUMAN SLIT-ROBO Rho GTPase activating protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=SRGAP2 PE=1 SV=1
2	A0A0G2JVF0	0.0	702	965	0.343	0.380	A0A0G2JVF0_RAT Rho GTPase activating protein 4 OS=Rattus norvegicus OX=10116 GN=Arhgap4 PE=1 SV=2
3	A0A286YEY3	0.0	926	459	0.420	0.980	A0A286YEY3_HUMAN SLIT-ROBO Rho GTPase activating protein 2B OS=Homo sapiens OX=9606 GN=SRGAP2B PE=1 SV=1
4	A0A8I5ZY52	0.0	676	921	0.333	0.388	A0A8I5ZY52_RAT Rho GTPase activating protein 4 OS=Rattus norvegicus OX=10116 GN=Arhgap4 PE=4 SV=1
5	A0A8I6AIK5	0.0	679	934	0.333	0.382	A0A8I6AIK5_RAT Rho GTPase activating protein 4 OS=Rattus norvegicus OX=10116 GN=Arhgap4 PE=4 SV=1
6	B7ZM87	0.0	2224	1070	0.999	1.000	B7ZM87_HUMAN SLIT-ROBO Rho GTPase activating protein 2 OS=Homo sapiens OX=9606 GN=SRGAP2 PE=1 SV=1
7	D4A208	0.0	2194	1071	0.980	0.980	SRGP2_RAT SLIT-ROBO Rho GTPase-activating protein 2 OS=Rattus norvegicus OX=10116 GN=Srgap2 PE=1 SV=1
8	E7EQN5	0.0	739	925	0.347	0.402	E7EQN5_HUMAN Rho GTPase activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=1
9	O43295	0.0	1251	1099	0.599	0.584	SRGP3_HUMAN SLIT-ROBO Rho GTPase-activating protein 3 OS=Homo sapiens OX=9606 GN=SRGAP3 PE=1 SV=3
10	O75044	0.0	2230	1071	1.000	1.000	SRGP2_HUMAN SLIT-ROBO Rho GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=SRGAP2 PE=1 SV=3
11	P0DJJ0	0.0	917	459	0.417	0.974	SRG2C_HUMAN SLIT-ROBO Rho GTPase-activating protein 2C OS=Homo sapiens OX=9606 GN=SRGAP2C PE=1 SV=1
12	P98171	0.0	768	946	0.356	0.403	RHG04_HUMAN Rho GTPase-activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=2
13	Q5VZB4	0.0	952	450	0.420	1.000	Q5VZB4_HUMAN SLIT-ROBO Rho GTPase activating protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=SRGAP2 PE=1 SV=1
14	Q7Z6B7	0.0	1458	1085	0.686	0.677	SRGP1_HUMAN SLIT-ROBO Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=SRGAP1 PE=1 SV=1
15	Q812A2	0.0	1246	1099	0.590	0.575	SRGP3_MOUSE SLIT-ROBO Rho GTPase-activating protein 3 OS=Mus musculus OX=10090 GN=Srgap3 PE=1 SV=1
16	Q8K4G7	0.0	702	965	0.342	0.379	Q8K4G7_RAT Rho GTPase activating protein 4 OS=Rattus norvegicus OX=10116 GN=Arhgap4 PE=2 SV=1
17	Q91Z67	0.0	2198	1071	0.982	0.982	SRGP2_MOUSE SLIT-ROBO Rho GTPase-activating protein 2 OS=Mus musculus OX=10090 GN=Srgap2 PE=1 SV=2
18	Q91Z69	0.0	1469	1062	0.683	0.688	SRGP1_MOUSE SLIT-ROBO Rho GTPase-activating protein 1 OS=Mus musculus OX=10090 GN=Srgap1 PE=1 SV=2
19	A0A075B7E6	9.06e-157	465	224	0.203	0.969	A0A075B7E6_HUMAN SLIT-ROBO Rho GTPase activating protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=SRGAP2 PE=1 SV=1
20	Q8IXS7	1.43e-153	461	335	0.215	0.687	Q8IXS7_HUMAN SRGAP3 protein OS=Homo sapiens OX=9606 GN=SRGAP3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00611 FCH	5.6e-18	76.4	Fes/CIP4, and EFC/F-BAR homology domain
2	PF00620 RhoGAP	1.3e-41	153.4	RhoGAP domain
3	PF00018 SH3_1	1.4e-06	39.1	SH3 domain
4	PF07653 SH3_2	2e-05	35.6	Variant SH3 domain
5	PF14604 SH3_9	3.9e-05	34.8	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000459615

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000420321	0.981	Roundabout homolog 1
2	9606.ENSP00000383118	0.966	Cell division control protein 42 homolog
3	9606.ENSP00000417335	0.902	Roundabout homolog 2
4	9606.ENSP00000373347	0.884	SLIT-ROBO Rho GTPase-activating protein 3
5	9606.ENSP00000347198	0.870	SLIT-ROBO Rho GTPase-activating protein 1
6	9606.ENSP00000376368	0.869	Wiskott-Aldrich syndrome protein family member 1
7	9606.ENSP00000329219	0.841	Formin-like protein 1
8	9606.ENSP00000363436	0.812	G protein-regulated inducer of neurite outgrowth 2
9	9606.ENSP00000377197	0.811	Hydrocephalus-inducing protein homolog
10	9606.ENSP00000348461	0.790	Ras-related C3 botulinum toxin substrate 1
11	9606.ENSP00000320324	0.774	Puromycin-sensitive aminopeptidase
12	9606.ENSP00000474456	0.774	Neuroblastoma breakpoint family member 1
13	9606.ENSP00000478609	0.772	Neuroblastoma breakpoint family member 1
14	9606.ENSP00000320401	0.769	UDP-glucuronosyltransferase 2B17
15	9606.ENSP00000306129	0.765	D(1B) dopamine receptor
16	9606.ENSP00000422591	0.738	Slit homolog 2 protein
17	9606.ENSP00000460070	0.734	General transcription factor II-I
18	9606.ENSP00000316543	0.711	Ras-associated and pleckstrin homology domains-containing protein 1
19	9606.ENSP00000223023	0.705	Neural Wiskott-Aldrich syndrome protein
20	9606.ENSP00000410603	0.697	Protein FAM131B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005096	1.000	GTPase activator activity
GO:0031267	0.998	small GTPase binding
GO:0046983	0.993	protein dimerization activity
GO:0042802	0.993	identical protein binding
GO:0042803	0.782	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048870	0.995	cell motility
GO:0065007	0.991	biological regulation
GO:0016043	0.991	cellular component organization
GO:0048731	0.985	system development
GO:0050794	0.984	regulation of cellular process
GO:0030030	0.964	cell projection organization
GO:0022607	0.956	cellular component assembly
GO:0007399	0.949	nervous system development
GO:0120036	0.925	plasma membrane bounded cell projection organization
GO:0030334	0.920	regulation of cell migration
GO:0016477	0.915	cell migration
GO:0043547	0.909	positive regulation of GTPase activity
GO:0034329	0.852	cell junction assembly
GO:0120031	0.792	plasma membrane bounded cell projection assembly
GO:0048869	0.788	cellular developmental process
GO:0030154	0.765	cell differentiation
GO:0046847	0.751	filopodium assembly
GO:0022008	0.722	neurogenesis
GO:0050808	0.718	synapse organization
GO:0050896	0.657	response to stimulus
GO:0048468	0.637	cell development
GO:0060996	0.630	dendritic spine development
GO:0048583	0.604	regulation of response to stimulus
GO:0051716	0.540	cellular response to stimulus
GO:0007154	0.531	cell communication
GO:0023052	0.529	signaling
GO:0007165	0.524	signal transduction
GO:0051056	0.466	regulation of small GTPase mediated signal transduction
GO:0048519	0.450	negative regulation of biological process
GO:0006996	0.422	organelle organization
GO:0007010	0.403	cytoskeleton organization
GO:0051128	0.354	regulation of cellular component organization
GO:0007416	0.342	synapse assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0005634	0.978	nucleus
GO:0031981	0.910	nuclear lumen
GO:0005654	0.903	nucleoplasm
GO:0016020	0.821	membrane
GO:0071944	0.478	cell periphery
GO:0005886	0.419	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]