StarFunc result for job id O75051

User Input

>input (1894 residues)
MEQRRPWPRALEVDSRSVVLLSVVWVLLAPPAAGMPQFSTFHSENRDWTFNHLTVHQGTG
AVYVGAINRVYKLTGNLTIQVAHKTGPEEDNKSCYPPLIVQPCSEVLTLTNNVNKLLIID
YSENRLLACGSLYQGVCKLLRLDDLFILVEPSHKKEHYLSSVNKTGTMYGVIVRSEGEDG
KLFIGTAVDGKQDYFPTLSSRKLPRDPESSAMLDYELHSDFVSSLIKIPSDTLALVSHFD
IFYIYGFASGGFVYFLTVQPETPEGVAINSAGDLFYTSRIVRLCKDDPKFHSYVSLPFGC
TRAGVEYRLLQAAYLAKPGDSLAQAFNITSQDDVLFAIFSKGQKQYHHPPDDSALCAFPI
RAINLQIKERLQSCYQGEGNLELNWLLGKDVQCTKAPVPIDDNFCGLDINQPLGGSTPVE
GLTLYTTSRDRMTSVASYVYNGYSVVFVGTKSGKLKKIRADGPPHGGVQYEMVSVLKDGS
PILRDMAFSIDQRYLYVMSERQVTRVPVESCEQYTTCGECLSSGDPHCGWCALHNMCSRR
DKCQQAWEPNRFAASISQCVSLAVHPSSISVSEHSRLLSLVVSDAPDLSAGIACAFGNLT
EVEGQVSGSQVICISPGPKDVPVIPLDQDWFGLELQLRSKETGKIFVSTEFKFYNCSAHQ
LCLSCVNSAFRCHWCKYRNLCTHDPTTCSFQEGRINISEDCPQLVPTEEILIPVGEVKPI
TLKARNLPQPQSGQRGYECVLNIQGAIHRVPALRFNSSSVQCQNSSYQYDGMDISNLAVD
FAVVWNGNFIIDNPQDLKVHLYKCAAQRESCGLCLKADRKFECGWCSGERRCTLHQHCTS
PSSPWLDWSSHNVKCSNPQITEILTVSGPPEGGTRVTIHGVNLGLDFSEIAHHVQVAGVP
CTPLPGEYIIAEQIVCEMGHALVGTTSGPVRLCIGECKPEFMTKSHQQYTFVNPSVLSLN
PIRGPESGGTMVTITGHYLGAGSSVAVYLGNQTCEFYGRSMSEIVCVSPPSSNGLGPVPV
SVSVDRAHVDSNLQFEYIDDPRVQRIEPEWSIASGHTPLTITGFNLDVIQEPRIRVKFNG
KESVNVCKVVNTTTLTCLAPSLTTDYRPGLDTVERPDEFGFVFNNVQSLLIYNDTKFIYY
PNPTFELLSPTGVLDQKPGSPIILKGKNLCPPASGGAKLNYTVLIGETPCAVTVSETQLL
CEPPNLTGQHKVMVHVGGMVFSPGSVSVISDSLLTLPAIVSIAAGGSLLLIIVIIVLIAY
KRKSRENDLTLKRLQMQMDNLESRVALECKEAFAELQTDINELTSDLDRSGIPYLDYRTY
AMRVLFPGIEDHPVLRELEVQGNGQQHVEKALKLFAQLINNKVFLLTFIRTLELQRSFSM
RDRGNVASLIMTGLQGRLEYATDVLKQLLSDLIDKNLENKNHPKLLLRRTESVAEKMLTN
WFAFLLHKFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIEYKTL
ILNCVNPDNENSPEIPVKVLNCDTITQVKEKILDAVYKNVPYSQRPRAVDMDLEWRQGRI
ARVVLQDEDITTKIEGDWKRLNTLMHYQVSDRSVVALVPKQTSSYNIPASASISRTSISR
YDSSFRYTGSPDSLRSRAPMITPDLESGVKVWHLVKNHDHGDQKEGDRGSKMVSEIYLTR
LLATKGTLQKFVDDLFETLFSTVHRGSALPLAIKYMFDFLDEQADRHSIHDTDVRHTWKS
NCLPLRFWVNVIKNPQFVFDIHKGSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLY
AKDIPSYKSWVERYYADIAKLPAISDQDMNAYLAEQSRLHAVEFNMLSALNEIYSYVSKY
SEELIGALEQDEQARRQRLAYKVEQLINAMSIES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IRZ9	0.489	0.478	0.000	1945	0.294	0.286	A0A0R4IRZ9.pdb.gz
2	AFDB:A0A2R8QPJ6	0.650	0.647	0.000	1902	0.818	0.814	A0A2R8QPJ6.pdb.gz	A0A2R8QPJ6_DANRE Plexin-A2 OS=Danio rerio OX=7955 GN=plxna2 PE=1 SV=1
3	AFDB:B0S5N4	0.639	0.639	0.000	1892	0.612	0.613	B0S5N4.pdb.gz	PLXA3_DANRE Plexin A3 OS=Danio rerio OX=7955 GN=plxna3 PE=2 SV=2
4	AFDB:B2RXS4	0.529	0.542	0.000	1842	0.317	0.326	B2RXS4.pdb.gz	PLXB2_MOUSE Plexin-B2 OS=Mus musculus OX=10090 GN=Plxnb2 PE=1 SV=1
5	AFDB:D3ZLH5	0.488	0.487	0.000	1902	0.337	0.335	D3ZLH5.pdb.gz	PLXB3_RAT Plexin-B3 OS=Rattus norvegicus OX=10116 GN=Plxnb3 PE=1 SV=1
6	AFDB:F1Q7U0	0.454	0.394	0.000	2220	0.362	0.309	F1Q7U0.pdb.gz	F1Q7U0_DANRE Plexin b1b OS=Danio rerio OX=7955 GN=plxnb1b PE=1 SV=1
7	AFDB:F1QBC0	0.522	0.529	0.000	1864	0.317	0.322	F1QBC0.pdb.gz	F1QBC0_DANRE Plexin b2a OS=Danio rerio OX=7955 GN=fk37b01 PE=1 SV=3
8	AFDB:O15031	0.523	0.537	0.000	1838	0.326	0.336	O15031.pdb.gz	PLXB2_HUMAN Plexin-B2 OS=Homo sapiens OX=9606 GN=PLXNB2 PE=1 SV=3
9	AFDB:O43157	0.440	0.395	0.000	2135	0.358	0.318	O43157.pdb.gz	PLXB1_HUMAN Plexin-B1 OS=Homo sapiens OX=9606 GN=PLXNB1 PE=1 SV=3
10	AFDB:O45657	0.356	0.376	0.000	1766	0.253	0.272	O45657.pdb.gz	PLX2_CAEEL Plexin-2 OS=Caenorhabditis elegans OX=6239 GN=plx-2 PE=1 SV=5
11	PDB:6vxkB	0.201	0.480	1.332E-22	747	0.071	0.179	6vxkB.pdb.gz
12	PDB:6qp7A	0.199	0.547	5.330E-19	620	0.053	0.161	6qp7A.pdb.gz	Diversity of oligomerization in Drosophila semaphorins suggests a mechanism of functional fine-tuning.
13	PDB:3nvqA	0.202	0.572	1.026E-16	588	0.056	0.182	3nvqA.pdb.gz
14	PDB:3nvnA	0.159	0.665	4.687E-10	383	0.034	0.167	3nvnA.pdb.gz	Structural Basis of Semaphorin-Plexin Recognition and Viral Mimicry from Sema7A and A39R Complexes with PlexinC1.
15	PDB:4lnvA	0.079	0.107	3.857E-8	1276	0.047	0.070	4lnvA.pdb.gz
16	PDB:1e07A	0.062	0.136	5.780E-8	642	0.033	0.097	1e07A.pdb.gz
17	PDB:4aq1A	0.055	0.102	3.717E-7	721	0.029	0.075	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
18	PDB:5e7gA	0.067	0.189	6.550E-7	446	0.030	0.128	5e7gA.pdb.gz	Molecular Dissection of Xyloglucan Recognition in a Prominent Human Gut Symbiont.
19	PDB:5oj2B	0.095	0.177	6.821E-7	692	0.042	0.116	5oj2B.pdb.gz
20	PDB:5a42A	0.076	0.086	8.019E-7	1597	0.059	0.070	5a42A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A2R8QPJ6	3220	1902	0.816	0.812	A0A2R8QPJ6_DANRE Plexin-A2 OS=Danio rerio OX=7955 GN=plxna2 PE=1 SV=1
2	A8IYK2	2431	1885	0.625	0.628	A8IYK2_DANRE Plexin-A1 OS=Danio rerio OX=7955 GN=plxna1 PE=1 SV=1
3	B0S5N4	2397	1892	0.609	0.610	PLXA3_DANRE Plexin A3 OS=Danio rerio OX=7955 GN=plxna3 PE=2 SV=2
4	B2RXS4	918	1842	0.339	0.349	PLXB2_MOUSE Plexin-B2 OS=Mus musculus OX=10090 GN=Plxnb2 PE=1 SV=1
5	C5H5I1	934	1864	0.331	0.336	C5H5I1_DANRE Plexin B2 OS=Danio rerio OX=7955 GN=plxnB2 PE=1 SV=1
6	D3ZLH5	988	1902	0.353	0.352	PLXB3_RAT Plexin-B3 OS=Rattus norvegicus OX=10116 GN=Plxnb3 PE=1 SV=1
7	F1Q7U0	826	2220	0.263	0.224	F1Q7U0_DANRE Plexin b1b OS=Danio rerio OX=7955 GN=plxnb1b PE=1 SV=1
8	F1QBC0	936	1864	0.331	0.336	F1QBC0_DANRE Plexin b2a OS=Danio rerio OX=7955 GN=fk37b01 PE=1 SV=3
9	H9XVP3	1379	1928	0.422	0.414	H9XVP3_DROME Plexin A, isoform F OS=Drosophila melanogaster OX=7227 GN=PlexA PE=1 SV=1
10	O15031	939	1838	0.333	0.343	PLXB2_HUMAN Plexin-B2 OS=Homo sapiens OX=9606 GN=PLXNB2 PE=1 SV=3
11	O43157	809	2135	0.256	0.227	PLXB1_HUMAN Plexin-B1 OS=Homo sapiens OX=9606 GN=PLXNB1 PE=1 SV=3
12	O75051	3938	1894	1.000	1.000	PLXA2_HUMAN Plexin-A2 OS=Homo sapiens OX=9606 GN=PLXNA2 PE=1 SV=4
13	O96681	1384	1945	0.423	0.412	O96681_DROME Plexin A OS=Drosophila melanogaster OX=7227 GN=PlexA PE=2 SV=1
14	P51805	2282	1871	0.590	0.597	PLXA3_HUMAN Plexin-A3 OS=Homo sapiens OX=9606 GN=PLXNA3 PE=1 SV=3
15	P70206	2459	1894	0.631	0.631	PLXA1_MOUSE Plexin-A1 OS=Mus musculus OX=10090 GN=Plxna1 PE=1 SV=1
16	P70207	3823	1894	0.966	0.966	PLXA2_MOUSE Plexin-A2 OS=Mus musculus OX=10090 GN=Plxna2 PE=1 SV=2
17	P70208	2293	1872	0.591	0.598	PLXA3_MOUSE Plexin-A3 OS=Mus musculus OX=10090 GN=Plxna3 PE=1 SV=2
18	Q0KIF1	1190	1505	0.359	0.451	Q0KIF1_DROME Plexin A, isoform B OS=Drosophila melanogaster OX=7227 GN=PlexA PE=1 SV=1
19	Q3UH93	881	1925	0.338	0.332	PLXD1_MOUSE Plexin-D1 OS=Mus musculus OX=10090 GN=Plxnd1 PE=1 SV=1
20	Q3V5K0	1067	1945	0.359	0.349	Q3V5K0_CAEEL Sema domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=plx-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08337 Plexin_cytopl	2.7e-195	661.0	Plexin cytoplasmic RasGAP domain
2	PF20170 Plexin_RBD	6.5e-44	160.1	Plexin cytoplasmic RhoGTPase-binding domain
3	PF01437 PSI	4.6e-17	73.6	Plexin repeat
4	PF17205 PSI_integrin	4.1e+02	12.1	Integrin plexin domain
5	PF00616 RasGAP	2.7	19.2	GTPase-activator protein for Ras-like GTPase
6	PF01403 Sema	6.2e-21	86.6	Sema domain
7	PF01833 TIG	4.6e-38	140.5	IPT/TIG domain
8	PF18020 TIG_2	3.3e-27	106.3	TIG domain found in plexin
9	PF17960 TIG_plexin	4.3e-20	82.7	TIG domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356000

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265371	0.998	Neuropilin-1
2	9606.ENSP00000265362	0.995	Semaphorin-3A
3	9606.ENSP00000308461	0.988	Rho-related GTP-binding protein Rho6
4	9606.ENSP00000257414	0.986	Semaphorin-6A
5	9606.ENSP00000467290	0.977	Semaphorin-6B
6	9606.ENSP00000246792	0.951	Ras-related protein R-Ras
7	9606.ENSP00000353582	0.932	Neuropilin-2
8	9606.ENSP00000357909	0.929	Semaphorin-6C
9	9606.ENSP00000336740	0.925	LIM domain kinase 1
10	9606.ENSP00000309539	0.924	Dihydropyrimidinase-related protein 2
11	9606.ENSP00000324806	0.910	Glycogen synthase kinase-3 beta
12	9606.ENSP00000352882	0.906	Plexin-A4
13	9606.ENSP00000377061	0.905	Plexin-A1
14	9606.ENSP00000358696	0.904	Plexin-A3
15	9606.ENSP00000346671	0.897	Tyrosine-protein kinase Fyn
16	9606.ENSP00000249071	0.894	Ras-related C3 botulinum toxin substrate 2
17	9606.ENSP00000304283	0.894	Ras-related C3 botulinum toxin substrate 3
18	9606.ENSP00000484146	0.892	Semaphorin-3B
19	9606.ENSP00000303212	0.889	Semaphorin-3E
20	9606.ENSP00000350547	0.885	Semaphorin-4F

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0017154	1.000	semaphorin receptor activity
GO:0098772	0.464	molecular function regulator activity
GO:0140677	0.332	molecular function activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0009987	0.993	cellular process
GO:0048731	0.990	system development
GO:0050794	0.989	regulation of cellular process
GO:0009653	0.985	anatomical structure morphogenesis
GO:0007154	0.969	cell communication
GO:0051716	0.953	cellular response to stimulus
GO:0023052	0.951	signaling
GO:0071840	0.935	cellular component organization or biogenesis
GO:0071526	0.931	semaphorin-plexin signaling pathway
GO:0007399	0.928	nervous system development
GO:0016477	0.892	cell migration
GO:0009790	0.860	embryo development
GO:0040012	0.859	regulation of locomotion
GO:0030154	0.850	cell differentiation
GO:0048513	0.839	animal organ development
GO:0040011	0.796	locomotion
GO:0007417	0.783	central nervous system development
GO:0048699	0.767	generation of neurons
GO:0016043	0.727	cellular component organization
GO:0051128	0.662	regulation of cellular component organization
GO:0060322	0.652	head development
GO:0048518	0.639	positive regulation of biological process
GO:0048522	0.571	positive regulation of cellular process
GO:0048646	0.561	anatomical structure formation involved in morphogenesis
GO:0007420	0.524	brain development
GO:0030182	0.482	neuron differentiation
GO:0048583	0.464	regulation of response to stimulus
GO:0009888	0.462	tissue development
GO:0030900	0.460	forebrain development
GO:0048519	0.383	negative regulation of biological process
GO:0048666	0.368	neuron development
GO:0048729	0.361	tissue morphogenesis
GO:0048568	0.361	embryonic organ development
GO:0048598	0.350	embryonic morphogenesis
GO:0030334	0.348	regulation of cell migration
GO:0120035	0.347	regulation of plasma membrane bounded cell projection organization
GO:0009887	0.345	animal organ morphogenesis
GO:0048523	0.322	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0032991	0.969	protein-containing complex
GO:0043235	0.740	receptor complex
GO:0002116	0.390	semaphorin receptor complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]