StarFunc result for job id O75052

User Input

>input (506 residues)
MPSKTKYNLVDDGHDLRIPLHNEDAFQHGICFEAKYVGSLDVPRPNSRVEIVAAMRRIRY
EFKAKNIKKKKVSIMVSVDGVKVILKKKKKLLLLQKKEWTWDESKMLVMQDPIYRIFYVS
HDSQDLKIFSYIARDGASNIFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNA
DGQEDGESERNSNSSGDPGRQLTGAERASTATAEETDIDAVEVPLPGNDVLEFSRGVTDL
DAVGKEGGSHTGSKVSHPQEPMLTASPRMLLPSSSSKPPGLGTETPLSTHHQMQLLQQLL
QQQQQQTQVAVAQVHLLKDQLAAEAAARLEAQARVHQLLLQNKDMLQHISLLVKQVQELE
LKLSGQNAMGSQDSLLEITFRSGALPVLCDPTTPKPEDLHSPPLGAGLADFAHPAGSPLG
RRDCLVKLECFRFLPPEDTPPPAQGEALLGGLELIKFRESGIASEYESNTDESEERDSWS
QEELPRLLNVLQRQELGDGLDDEIAV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75052	1.000	1.000	1.481E-71	506	1.000	1.000	O75052.pdb.gz	CAPON_HUMAN Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein OS=Homo sapiens OX=9606 GN=NOS1AP PE=1 SV=3
2	AFDB:Q8STF6	0.353	0.209	1.189E-29	887	0.431	0.246	Q8STF6.pdb.gz	DYC1_CAEEL Dystrophin-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=dyc-1 PE=1 SV=1
3	AFDB:P59672	0.284	0.129	4.853E-10	1150	0.091	0.040	P59672.pdb.gz	ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus OX=10090 GN=Anks1a PE=1 SV=3
4	AFDB:P33332	0.148	0.060	5.584E-5	1336	0.158	0.060	P33332.pdb.gz	SEC3_YEAST Exocyst complex component SEC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC3 PE=1 SV=1
5	AFDB:A0A0G2K1Q9	0.142	0.084	1.504E-4	923	0.117	0.064	A0A0G2K1Q9.pdb.gz	A0A0G2K1Q9_RAT Erythrocyte membrane protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=4 SV=2
6	AFDB:Q17795	0.181	0.153	3.207E-4	607	0.123	0.102	Q17795.pdb.gz	Q17795_CAEEL CRIB domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=wsp-1 PE=1 SV=3
7	AFDB:Q9QZA1	0.193	0.231	3.399E-4	407	0.055	0.069	Q9QZA1.pdb.gz	PHLA1_RAT Pleckstrin homology-like domain family A member 1 OS=Rattus norvegicus OX=10116 GN=Phlda1 PE=2 SV=2
8	AFDB:O17583	0.276	0.149	4.549E-4	982	0.063	0.033	O17583.pdb.gz	LIN10_CAEEL Protein lin-10 OS=Caenorhabditis elegans OX=6239 GN=lin-10 PE=1 SV=1
9	AFDB:A0A2R8YCW8	0.175	0.123	5.111E-4	748	0.123	0.083	A0A2R8YCW8.pdb.gz	A0A2R8YCW8_HUMAN Erythrocyte membrane protein band 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
10	AFDB:Q9VZZ9	0.137	0.086	8.147E-4	878	0.136	0.079	Q9VZZ9.pdb.gz	DOS_DROME Protein daughter of sevenless OS=Drosophila melanogaster OX=7227 GN=dos PE=1 SV=1
11	PDB:4gouA	0.168	0.168	8.433E-4	507	0.028	0.028	4gouA.pdb.gz
12	PDB:4rm8A	0.144	0.191	2.704E-3	368	0.042	0.057	4rm8A.pdb.gz
13	PDB:5yqrA	0.120	0.216	2.867E-3	268	0.020	0.037	5yqrA.pdb.gz
14	PDB:4iapA	0.133	0.245	3.039E-3	256	0.040	0.078	4iapA.pdb.gz
15	PDB:3m1iB	0.163	0.502	3.414E-3	131	0.030	0.115	3m1iB.pdb.gz	An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
16	PDB:7mp5A	0.139	0.049	3.836E-3	1629	0.034	0.010	7mp5A.pdb.gz
17	PDB:1k5dB	0.166	0.487	4.310E-3	146	0.020	0.068	1k5dB.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
18	PDB:6hhgA	0.162	0.207	6.114E-3	386	0.022	0.028	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
19	PDB:6e5lA	0.100	0.276	1.161E-2	140	0.034	0.121	6e5lA.pdb.gz	Abnormal Cannabidiol Modulates Vitamin A Metabolism by Acting as a Competitive Inhibitor of CRBP1.
20	PDB:4mt6A	0.153	0.193	1.304E-2	389	0.024	0.031	4mt6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0VD63	0.0	720	448	0.838	0.946	H0VD63_CAVPO Nitric oxide synthase 1 adaptor protein OS=Cavia porcellus OX=10141 GN=NOS1AP PE=4 SV=2
2	O54960	0.0	849	503	0.941	0.946	CAPON_RAT Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein OS=Rattus norvegicus OX=10116 GN=Nos1ap PE=1 SV=1
3	O75052	0.0	1041	506	1.000	1.000	CAPON_HUMAN Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein OS=Homo sapiens OX=9606 GN=NOS1AP PE=1 SV=3
4	Q9D3A8	0.0	865	503	0.951	0.956	CAPON_MOUSE Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein OS=Mus musculus OX=10090 GN=Nos1ap PE=1 SV=3
5	Q8STF6	2.29e-79	267	887	0.243	0.139	DYC1_CAEEL Dystrophin-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=dyc-1 PE=1 SV=1
6	Q5SW96	3.58e-12	69.7	308	0.168	0.276	ARH_HUMAN Low density lipoprotein receptor adapter protein 1 OS=Homo sapiens OX=9606 GN=LDLRAP1 PE=1 SV=3
7	Q9UBP9	8.71e-12	68.2	304	0.093	0.155	GULP1_HUMAN PTB domain-containing engulfment adapter protein 1 OS=Homo sapiens OX=9606 GN=GULP1 PE=1 SV=1
8	Q8C142	3.43e-10	63.5	308	0.087	0.143	ARH_MOUSE Low density lipoprotein receptor adapter protein 1 OS=Mus musculus OX=10090 GN=Ldlrap1 PE=1 SV=3
9	D3ZAR1	3.06e-09	60.5	306	0.087	0.144	ARH_RAT Low density lipoprotein receptor adapter protein 1 OS=Rattus norvegicus OX=10116 GN=Ldlrap1 PE=1 SV=2
10	F1LIN5	4.90e-09	60.8	535	0.099	0.093	F1LIN5_CAEEL PID domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=num-1 PE=1 SV=1
11	Q8BIZ1	5.86e-09	61.2	1259	0.083	0.033	ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus OX=10090 GN=Anks1b PE=1 SV=3
12	Q92625	6.91e-09	60.8	1134	0.085	0.038	ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=4
13	A1L1I3	7.16e-09	60.5	614	0.087	0.072	NUMBL_RAT Numb-like protein OS=Rattus norvegicus OX=10116 GN=Numbl PE=1 SV=1
14	O08919	7.41e-09	60.5	604	0.087	0.073	NUMBL_MOUSE Numb-like protein OS=Mus musculus OX=10090 GN=Numbl PE=1 SV=3
15	Q9XTY6	8.87e-09	60.5	593	0.099	0.084	NUMB1_CAEEL Numb-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=num-1 PE=1 SV=1
16	P0C6S7	9.02e-09	60.8	1260	0.085	0.034	ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus OX=10116 GN=Anks1b PE=1 SV=1
17	A0A3B3ISP1	9.14e-09	60.5	1194	0.085	0.036	A0A3B3ISP1_HUMAN Ankyrin repeat and sterile alpha motif domain containing 1A OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=1
18	Q7Z6G8	9.56e-09	60.5	1248	0.085	0.034	ANS1B_HUMAN Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens OX=9606 GN=ANKS1B PE=1 SV=2
19	O76337	9.63e-09	60.1	492	0.099	0.102	CED6_CAEEL Cell death protein 6 OS=Caenorhabditis elegans OX=6239 GN=ced-6 PE=1 SV=1
20	Q9Y6R0	1.05e-08	60.1	609	0.087	0.072	NUMBL_HUMAN Numb-like protein OS=Homo sapiens OX=9606 GN=NUMBL PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05929 Phage_GPO	2.3e+02	12.8	Phage capsid scaffolding protein (GPO) serine peptidase
2	PF00640 PID	5.9e-27	105.9	Phosphotyrosine interaction domain (PTB/PID)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355133

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000477999	0.999	Nitric oxide synthase, brain
2	9606.ENSP00000225688	0.997	Dexamethasone-induced Ras-related protein 1
3	9606.ENSP00000382428	0.930	Disks large homolog 4
4	9606.ENSP00000347672	0.861	VANGL planar cell polarity protein 1
5	9606.ENSP00000324422	0.846	Zyxin
6	9606.ENSP00000200457	0.843	Thyroid receptor-interacting protein 6
7	9606.ENSP00000262713	0.843	LIM domain-containing protein ajuba
8	9606.ENSP00000273317	0.843	LIM domain-containing protein 1
9	9606.ENSP00000416387	0.843	Filamin-binding LIM protein 1
10	9606.ENSP00000466953	0.843	Wilms tumor protein 1-interacting protein
11	9606.ENSP00000482472	0.843	Lipoma-preferred partner
12	9606.ENSP00000401018	0.820	GINS complex subunit 3
13	9606.ENSP00000324404	0.808	Trichoplein keratin filament-binding protein
14	9606.ENSP00000295987	0.802	Synapsin-1
15	9606.ENSP00000155840	0.777	Potassium voltage-gated channel subfamily KQT member 1
16	9606.ENSP00000420270	0.774	Serine/threonine-protein kinase Kist
17	9606.ENSP00000386104	0.744	Carboxypeptidase E
18	9606.ENSP00000217381	0.714	Alpha-1-syntrophin
19	9606.ENSP00000262186	0.707	Potassium voltage-gated channel subfamily H member 2
20	9606.ENSP00000367173	0.696	RING finger protein 207

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0050998	0.812	nitric-oxide synthase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050794	0.991	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0065008	0.977	regulation of biological quality
GO:0032879	0.976	regulation of localization
GO:0043269	0.961	regulation of monoatomic ion transport
GO:0016043	0.958	cellular component organization
GO:0010959	0.940	regulation of metal ion transport
GO:1904062	0.940	regulation of monoatomic cation transmembrane transport
GO:0042391	0.930	regulation of membrane potential
GO:0051924	0.906	regulation of calcium ion transport
GO:1903169	0.852	regulation of calcium ion transmembrane transport
GO:0098900	0.845	regulation of action potential
GO:0048518	0.735	positive regulation of biological process
GO:0065009	0.721	regulation of molecular function
GO:0019222	0.585	regulation of metabolic process
GO:0060255	0.526	regulation of macromolecule metabolic process
GO:0032501	0.497	multicellular organismal process
GO:0050896	0.489	response to stimulus
GO:0048522	0.439	positive regulation of cellular process
GO:0051716	0.394	cellular response to stimulus
GO:0032409	0.390	regulation of transporter activity
GO:0048519	0.386	negative regulation of biological process
GO:0051171	0.380	regulation of nitrogen compound metabolic process
GO:0031323	0.372	regulation of cellular metabolic process
GO:0009893	0.370	positive regulation of metabolic process
GO:0022898	0.359	regulation of transmembrane transporter activity
GO:0032412	0.352	regulation of monoatomic ion transmembrane transporter activity
GO:0051239	0.333	regulation of multicellular organismal process
GO:0048856	0.308	anatomical structure development
GO:0048523	0.308	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0012505	0.998	endomembrane system
GO:0005886	0.997	plasma membrane
GO:0043229	0.996	intracellular organelle
GO:0043231	0.993	intracellular membrane-bounded organelle
GO:0030054	0.944	cell junction
GO:0005634	0.902	nucleus
GO:0005829	0.900	cytosol
GO:0045202	0.691	synapse
GO:0043232	0.658	intracellular non-membrane-bounded organelle
GO:0070013	0.518	intracellular organelle lumen
GO:0031090	0.486	organelle membrane
GO:0031981	0.469	nuclear lumen
GO:0005654	0.337	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]