StarFunc result for job id O75054

User Input

>input (1194 residues)
MKCFFPVLSCLAVLGVVSAQRQVTVQEGPLYRTEGSHITIWCNVSGYQGPSEQNFQWSIY
LPSSPEREVQIVSTMDSSFPYAIYTQRVRGGKIFIERVQGNSTLLHITDLQARDAGEYEC
HTPSTDKQYFGSYSAKMNLVVIPDSLQTTAMPQTLHRVEQDPLELTCEVASETIQHSHLS
VAWLRQKVGEKPVEVISLSRDFMLHSSSEYAQRQSLGEVRLDKLGRTTFRLTIFHLQPSD
QGEFYCEAAEWIQDPDGSWYAMTRKRSEGAVVNVQPTDKEFTVRLETEKRLHTVGEPVEF
RCILEAQNVPDRYFAVSWAFNSSLIATMGPNAVPVLNSEFAHREARGQLKVAKESDSVFV
LKIYHLRQEDSGKYNCRVTEREKTVTGEFIDKESKRPKNIPIIVLPLKSSISVEVASNAS
VILEGEDLRFSCSVRTAGRPQGRFSVIWQLVDRQNRRSNIMWLDRDGTVQPGSSYWERSS
FGGVQMEQVQPNSFSLGIFNSRKEDEGQYECHVTEWVRAVDGEWQIVGERRASTPISITA
LEMGFAVTAISRTPGVTYSDSFDLQCIIKPHYPAWVPVSVTWRFQPVGTVEFHDLVTFTR
DGGVQWGDRSSSFRTRTAIEKAESSNNVRLSISRASDTEAGKYQCVAELWRKNYNNTWTR
LAERTSNLLEIRVLQPVTKLQVSKSKRTLTLVENKPIQLNCSVKSQTSQNSHFAVLWYVH
KPSDADGKLILKTTHNSAFEYGTYAEEEGLRARLQFERHVSGGLFSLTVQRAEVSDSGSY
YCHVEEWLLSPNYAWYKLAEEVSGRTEVTVKQPDSRLRLSQAQGNLSVLETRQVQLECVV
LNRTSITSQLMVEWFVWKPNHPERETVARLSRDATFHYGEQAAKNNLKGRLHLESPSPGV
YRLFIQNVAVQDSGTYSCHVEEWLPSPSGMWYKRAEDTAGQTALTVMRPDASLQVDTVVP
NATVSEKAAFQLDCSIVSRSSQDSRFAVAWYSLRTKAGGKRSSPGLEEQEEEREEEEEED
DDDDDDPTERTALLSVGPDAVFGPEGSPWEGRLRFQRLSPVLYRLTVLQASPQDTGNYSC
HVEEWLPSPQKEWYRLTEEESAPIGIRVLDTSPTLQSIICSNDALFYFVFFYPFPIFGIL
IITILLVRFKSRNSSKNSDGKNGVPLLWIKEPHLNYSPTCLEPPVLSIHPGAID

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75054	1.000	1.000	0.000	1194	1.000	1.000	O75054.pdb.gz	IGSF3_HUMAN Immunoglobulin superfamily member 3 OS=Homo sapiens OX=9606 GN=IGSF3 PE=2 SV=3
2	AFDB:Q93033	0.298	0.342	0.000	1021	0.315	0.368	Q93033.pdb.gz	IGSF2_HUMAN Immunoglobulin superfamily member 2 OS=Homo sapiens OX=9606 GN=CD101 PE=1 SV=2
3	AFDB:A8E0Y8	0.315	0.359	4.461E-102	1033	0.283	0.327	A8E0Y8.pdb.gz	IGSF2_MOUSE Immunoglobulin superfamily member 2 OS=Mus musculus OX=10090 GN=Cd101 PE=2 SV=1
4	AFDB:Q62786	0.288	0.376	2.727E-65	879	0.173	0.235	Q62786.pdb.gz	FPRP_RAT Prostaglandin F2 receptor negative regulator OS=Rattus norvegicus OX=10116 GN=Ptgfrn PE=1 SV=1
5	AFDB:Q9P2B2	0.266	0.338	2.858E-65	879	0.180	0.245	Q9P2B2.pdb.gz	FPRP_HUMAN Prostaglandin F2 receptor negative regulator OS=Homo sapiens OX=9606 GN=PTGFRN PE=1 SV=2
6	AFDB:Q969P0	0.301	0.550	3.240E-51	613	0.151	0.294	Q969P0.pdb.gz	IGSF8_HUMAN Immunoglobulin superfamily member 8 OS=Homo sapiens OX=9606 GN=IGSF8 PE=1 SV=1
7	AFDB:Q8R366	0.303	0.559	1.097E-50	611	0.147	0.288	Q8R366.pdb.gz	IGSF8_MOUSE Immunoglobulin superfamily member 8 OS=Mus musculus OX=10090 GN=Igsf8 PE=1 SV=2
8	AFDB:Q6NZ26	0.290	0.528	2.381E-45	615	0.128	0.249	Q6NZ26.pdb.gz
9	AFDB:Q9NEG0	0.147	0.182	4.583E-34	907	0.145	0.191	Q9NEG0.pdb.gz	Q9NEG0_DROME EG:BACR25B3.10 protein OS=Drosophila melanogaster OX=7227 GN=trol PE=4 SV=1
10	AFDB:O60500	0.142	0.138	3.413E-31	1241	0.143	0.138	O60500.pdb.gz	NPHN_HUMAN Nephrin OS=Homo sapiens OX=9606 GN=NPHS1 PE=1 SV=1
11	PDB:1e07A	0.160	0.235	8.018E-27	642	0.101	0.187	1e07A.pdb.gz
12	PDB:5oj2B	0.105	0.153	2.968E-25	692	0.108	0.186	5oj2B.pdb.gz
13	PDB:5a42A	0.086	0.068	5.623E-21	1597	0.093	0.070	5a42A.pdb.gz
14	PDB:7sqcO0	0.136	0.140	1.191E-20	1140	0.070	0.074	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
15	PDB:4lnvA	0.085	0.081	2.296E-20	1276	0.077	0.072	4lnvA.pdb.gz
16	PDB:7q1yA	0.118	0.105	3.502E-20	1374	0.098	0.085	7q1yA.pdb.gz
17	PDB:7nycA	0.096	0.080	4.841E-19	1542	0.102	0.079	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
18	PDB:7vonA	0.106	0.093	5.294E-18	1399	0.079	0.067	7vonA.pdb.gz
19	PDB:6h03A	0.105	0.103	5.548E-18	1223	0.095	0.092	6h03A.pdb.gz
20	PDB:7q5zA	0.118	0.107	5.548E-18	1344	0.097	0.086	7q5zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8E0Y8	0.0	577	1033	0.298	0.345	IGSF2_MOUSE Immunoglobulin superfamily member 2 OS=Mus musculus OX=10090 GN=Cd101 PE=2 SV=1
2	O75054	0.0	2472	1194	1.000	1.000	IGSF3_HUMAN Immunoglobulin superfamily member 3 OS=Homo sapiens OX=9606 GN=IGSF3 PE=2 SV=3
3	Q93033	0.0	629	1021	0.306	0.357	IGSF2_HUMAN Immunoglobulin superfamily member 2 OS=Homo sapiens OX=9606 GN=CD101 PE=1 SV=2
4	Q969P0	3.32e-87	297	613	0.153	0.299	IGSF8_HUMAN Immunoglobulin superfamily member 8 OS=Homo sapiens OX=9606 GN=IGSF8 PE=1 SV=1
5	Q8R366	6.33e-85	291	611	0.156	0.304	IGSF8_MOUSE Immunoglobulin superfamily member 8 OS=Mus musculus OX=10090 GN=Igsf8 PE=1 SV=2
6	C9J8Z4	3.11e-71	242	301	0.101	0.402	C9J8Z4_HUMAN Immunoglobulin superfamily member 8 (Fragment) OS=Homo sapiens OX=9606 GN=IGSF8 PE=1 SV=1
7	Q9P2B2	3.74e-67	246	879	0.180	0.245	FPRP_HUMAN Prostaglandin F2 receptor negative regulator OS=Homo sapiens OX=9606 GN=PTGFRN PE=1 SV=2
8	Q62786	1.42e-64	238	879	0.185	0.251	FPRP_RAT Prostaglandin F2 receptor negative regulator OS=Rattus norvegicus OX=10116 GN=Ptgfrn PE=1 SV=1
9	Q9WV91	1.13e-62	233	879	0.181	0.246	FPRP_MOUSE Prostaglandin F2 receptor negative regulator OS=Mus musculus OX=10090 GN=Ptgfrn PE=1 SV=2
10	P98160	1.77e-09	65.1	4391	0.147	0.040	PGBM_HUMAN Basement membrane-specific heparan sulfate proteoglycan core protein OS=Homo sapiens OX=9606 GN=HSPG2 PE=1 SV=4
11	A0A8I6A2S5	1.15e-08	62.4	4402	0.116	0.032	A0A8I6A2S5_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=1
12	A0A8I6ASH2	1.18e-08	62.4	4387	0.116	0.032	A0A8I6ASH2_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=1
13	F1LTJ5	8.48e-06	52.8	2438	0.059	0.029	F1LTJ5_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=4
14	P01833	8.72e-06	52.4	764	0.101	0.158	PIGR_HUMAN Polymeric immunoglobulin receptor OS=Homo sapiens OX=9606 GN=PIGR PE=1 SV=4
15	Q05793	2.22e-04	48.1	3707	0.061	0.020	PGBM_MOUSE Basement membrane-specific heparan sulfate proteoglycan core protein OS=Mus musculus OX=10090 GN=Hspg2 PE=1 SV=1
16	Q8IW00	3.40e-04	46.6	320	0.023	0.084	VSTM4_HUMAN V-set and transmembrane domain-containing protein 4 OS=Homo sapiens OX=9606 GN=VSTM4 PE=1 SV=3
17	D3YXG0	3.81e-04	47.4	5634	0.111	0.024	HMCN1_MOUSE Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=1 SV=1
18	O01761	7.92e-04	46.6	8081	0.048	0.007	UNC89_CAEEL Muscle M-line assembly protein unc-89 OS=Caenorhabditis elegans OX=6239 GN=unc-89 PE=1 SV=3
19	G5ED27	0.001	46.2	5175	0.094	0.022	G5ED27_CAEEL Ig-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=him-4 PE=1 SV=1
20	G5EDG4	0.001	46.2	3962	0.093	0.028	G5EDG4_CAEEL Ig-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=him-4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12863 DUF3821	1.7	20.0	Domain of unknown function (DUF3821)
2	PF07679 I-set	1.5e-35	132.5	Immunoglobulin I-set domain
3	PF00047 ig	2e-27	106.5	Immunoglobulin domain
4	PF13895 Ig_2	1.8e-23	93.9	Immunoglobulin domain
5	PF13927 Ig_3	5.5e-46	166.3	Immunoglobulin domain
6	PF16706 Izumo-Ig	0.0045	28.2	Izumo-like Immunoglobulin domain
7	PF15234 LAT	2e+02	13.1	Linker for activation of T-cells
8	PF00428 Ribosomal_60s	8.6e+02	12.0	60s Acidic ribosomal protein
9	PF07686 V-set	2.4e-65	228.9	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358495

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000371958	0.740	CD9 antigen
2	9606.ENSP00000417050	0.709	Tetraspanin
3	9606.ENSP00000364691	0.677	Rootletin
4	9606.ENSP00000370208	0.667	RAB guanine nucleotide exchange factor 1
5	9606.ENSP00000347948	0.656	Tumor necrosis factor receptor superfamily member 14
6	9606.ENSP00000329312	0.649	Immunoglobulin lambda-like polypeptide 1
7	9606.ENSP00000384053	0.629	Cytokine receptor common subunit beta
8	9606.ENSP00000263645	0.609	CD81 antigen
9	9606.ENSP00000371419	0.582	poly(ADP-ribose) polymerase family member 4
10	9606.ENSP00000464893	0.556	RING finger protein unkempt homolog
11	9606.ENSP00000314508	0.555	Glucosylceramidase that catalyzes, within the lysosomal compartment, the hydrolysis of glucosylceramide/GlcCer into free ceramide and glucose . Thereby, plays a central role in the degradation of complex lipids and the turnover of cellular membranes . Through the production of ceramides, participates to the PKC-activated salvage pathway of ceramide formation . Also plays a role in cholesterol metabolism . May either catalyze the glucosylation of cholesterol, through a transglucosylation reaction that transfers glucose from glucosylceramide to cholesterol . The short chain saturated C8: [...]
12	9606.ENSP00000362387	0.519	Tetraspanin-15
13	9606.ENSP00000306760	0.508	Leucine-rich repeat-containing protein 45
14	9606.ENSP00000263087	0.504	Integrin alpha-E
15	9606.ENSP00000400895	0.504	Otogelin-like protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.967	developmental process
GO:0048732	0.914	gland development
GO:0035272	0.895	exocrine system development
GO:0009987	0.790	cellular process
GO:0065007	0.572	biological regulation
GO:0050789	0.559	regulation of biological process
GO:0050794	0.553	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0009986	0.979	cell surface
GO:0005886	0.942	plasma membrane
GO:0043226	0.921	organelle
GO:0043227	0.743	membrane-bounded organelle
GO:0005622	0.721	intracellular anatomical structure
GO:0043229	0.704	intracellular organelle
GO:0005576	0.606	extracellular region
GO:0005615	0.536	extracellular space
GO:0005737	0.425	cytoplasm
GO:1903561	0.315	extracellular vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]