StarFunc result for job id O75063

User Input

>input (409 residues)
MKLKQRVVLLAILLVIFIFTKVFLIDNLDTSAANREDQRAFHRMMTGLRVELAPKLDHTL
QSPWEIAAQWVVPREVYPEETPELGAVMHAMATKKIIKADVGYKGTQLKALLILEGGQKV
VFKPKRYSRDHVVEGEPYAGYDRHNAEVAAFHLDRILGFHRAPLVVGRFVNLRTEIKPVA
TEQLLSTFLTVGNNTCFYGKCYYCRETEPACADGDIMEGSVTLWLPDVWPLQKHRHPWGR
TYREGKLARWEYDESYCDAVKKTSPYDSGPRLLDIIDTAVFDYLIGNADRHHYESFQDDE
GASMLILLDNAKSFGNPSLDERSILAPLYQCCIIRVSTWNRLNYLKNGVLKSALKSAMAH
DPISPVLSDPHLDAVDQRLLSVLATVKQCTDQFGMDTVLVEDRMPLSHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R918	0.929	0.929	2.315E-77	409	1.000	1.000	A0A024R918.pdb.gz
2	AFDB:Q5RH51	0.941	0.941	2.176E-67	409	0.763	0.763	Q5RH51.pdb.gz	XYLK_DANRE Glycosaminoglycan xylosylkinase OS=Danio rerio OX=7955 GN=fam20b PE=2 SV=1
3	AFDB:Q8IXL6	0.817	0.576	1.518E-40	584	0.352	0.247	Q8IXL6.pdb.gz	FA20C_HUMAN Extracellular serine/threonine protein kinase FAM20C OS=Homo sapiens OX=9606 GN=FAM20C PE=1 SV=2
4	AFDB:B1WBN7	0.816	0.580	7.589E-40	579	0.355	0.250	B1WBN7.pdb.gz	B1WBN7_RAT FAM20C OS=Rattus norvegicus OX=10116 GN=Fam20c PE=2 SV=1
5	AFDB:Q1MTC0	0.821	0.666	9.406E-40	507	0.372	0.300	Q1MTC0.pdb.gz	Q1MTC0_DANRE Extracellular serine/threonine protein kinase FAM20C OS=Danio rerio OX=7955 GN=fam20cl PE=1 SV=1
6	AFDB:Q95T10	0.782	0.760	1.298E-39	421	0.369	0.359	Q95T10.pdb.gz	XYLK_DROME Glycosaminoglycan xylosylkinase homolog OS=Drosophila melanogaster OX=7227 GN=CG3631 PE=2 SV=1
7	AFDB:Q8CID3	0.813	0.618	1.552E-35	541	0.355	0.268	Q8CID3.pdb.gz	FA20A_MOUSE Pseudokinase FAM20A OS=Mus musculus OX=10090 GN=Fam20a PE=1 SV=1
8	AFDB:Q96MK3	0.810	0.617	1.552E-35	541	0.352	0.266	Q96MK3.pdb.gz	FA20A_HUMAN Pseudokinase FAM20A OS=Homo sapiens OX=9606 GN=FAM20A PE=1 SV=4
9	AFDB:A4VCL2	0.783	0.331	6.264E-35	980	0.347	0.145	A4VCL2.pdb.gz	FA20C_DROME Extracellular serine/threonine protein CG31145 OS=Drosophila melanogaster OX=7227 GN=CG31145 PE=2 SV=2
10	AFDB:Q9XTW2	0.813	0.654	3.487E-34	512	0.330	0.264	Q9XTW2.pdb.gz	FA20C_CAEEL Extracellular serine/threonine protein kinase CeFam20 OS=Caenorhabditis elegans OX=6239 GN=famk-1 PE=1 SV=1
11	PDB:5yh3A	0.802	0.750	3.994E-34	438	0.350	0.326	5yh3A.pdb.gz	Structure and evolution of the Fam20 kinases
12	PDB:3akkA	0.342	0.438	4.577E-4	296	0.095	0.132	3akkA.pdb.gz	Helicobacter pylori proinflammatory protein up-regulates NF-kappaB as a cell-translocating Ser/Thr kinase
13	PDB:8a5xA	0.317	0.283	1.080E-3	466	0.086	0.075	8a5xA.pdb.gz	Structure-based design and modular synthesis of novel PI4K class II inhibitors bearing a 4-aminoquinazoline scaffold.
14	PDB:4wtvB	0.307	0.297	1.490E-3	426	0.090	0.087	4wtvB.pdb.gz	The high-resolution crystal structure of phosphatidylinositol 4-kinase II beta and the crystal structure of phosphatidylinositol 4-kinase II alpha containing a nucleoside analogue provide a structural basis for isoform-specific inhibitor design.
15	PDB:5eutA	0.335	0.290	1.750E-3	485	0.117	0.099	5eutA.pdb.gz
16	PDB:4ajwA	0.272	0.170	7.452E-3	765	0.088	0.047	4ajwA.pdb.gz	Discovery and Optimization of New Benzimidazole- and Benzoxazole-Pyrimidone Selective Pi3Kbeta Inhibitors for the Treatment of Phosphatase and Tensin Homologue (Pten)-Deficient Cancers.
17	PDB:4ajwB	0.272	0.166	1.579E-2	792	0.086	0.044	4ajwB.pdb.gz	Discovery and Optimization of New Benzimidazole- and Benzoxazole-Pyrimidone Selective Pi3Kbeta Inhibitors for the Treatment of Phosphatase and Tensin Homologue (Pten)-Deficient Cancers.
18	PDB:7lq1A	0.273	0.143	3.532E-2	950	0.093	0.040	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
19	PDB:7sicA	0.263	0.059	3.727E-2	2773	0.110	0.016	7sicA.pdb.gz	Structure of the human ATM kinase and mechanism of Nbs1 binding.
20	PDB:3rp6A	0.105	0.107	7.095E-2	392	0.081	0.084	3rp6A.pdb.gz	Structural and Mechanistic Studies of HpxO, a Novel Flavin Adenine Dinucleotide-Dependent Urate Oxidase from Klebsiella pneumoniae.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75063	0.0	852	409	1.000	1.000	XYLK_HUMAN Glycosaminoglycan xylosylkinase OS=Homo sapiens OX=9606 GN=FAM20B PE=1 SV=1
2	Q5RH51	0.0	674	409	0.768	0.768	XYLK_DANRE Glycosaminoglycan xylosylkinase OS=Danio rerio OX=7955 GN=fam20b PE=2 SV=1
3	Q8VCS3	0.0	836	409	0.973	0.973	XYLK_MOUSE Glycosaminoglycan xylosylkinase OS=Mus musculus OX=10090 GN=Fam20b PE=1 SV=1
4	B1WBN7	2.36e-89	283	579	0.364	0.257	B1WBN7_RAT FAM20C OS=Rattus norvegicus OX=10116 GN=Fam20c PE=2 SV=1
5	Q5MJS3	1.42e-88	281	579	0.362	0.256	FA20C_MOUSE Extracellular serine/threonine protein kinase FAM20C OS=Mus musculus OX=10090 GN=Fam20c PE=1 SV=1
6	A0A8I5ZV45	1.66e-88	283	650	0.364	0.229	A0A8I5ZV45_RAT FAM20C, golgi associated secretory pathway kinase OS=Rattus norvegicus OX=10116 GN=Fam20c PE=3 SV=1
7	Q8IXL6	2.69e-87	278	584	0.347	0.243	FA20C_HUMAN Extracellular serine/threonine protein kinase FAM20C OS=Homo sapiens OX=9606 GN=FAM20C PE=1 SV=2
8	Q95T10	1.68e-83	263	421	0.342	0.333	XYLK_DROME Glycosaminoglycan xylosylkinase homolog OS=Drosophila melanogaster OX=7227 GN=CG3631 PE=2 SV=1
9	A4VCL2	3.30e-81	260	528	0.337	0.261	FA20C_DROME Extracellular serine/threonine protein CG31145 OS=Drosophila melanogaster OX=7227 GN=CG31145 PE=2 SV=2
10	B0V1R7	2.22e-78	252	502	0.342	0.279	B0V1R7_DANRE Extracellular serine/threonine protein kinase FAM20C OS=Danio rerio OX=7955 GN=fam20cl PE=1 SV=1
11	Q1MTC0	2.42e-78	252	507	0.342	0.276	Q1MTC0_DANRE Extracellular serine/threonine protein kinase FAM20C OS=Danio rerio OX=7955 GN=fam20cl PE=1 SV=1
12	Q8CID3	1.40e-71	236	541	0.333	0.251	FA20A_MOUSE Pseudokinase FAM20A OS=Mus musculus OX=10090 GN=Fam20a PE=1 SV=1
13	Q96MK3	1.44e-71	236	541	0.340	0.257	FA20A_HUMAN Pseudokinase FAM20A OS=Homo sapiens OX=9606 GN=FAM20A PE=1 SV=4
14	Q9XTW2	3.98e-70	231	512	0.330	0.264	FA20C_CAEEL Extracellular serine/threonine protein kinase CeFam20 OS=Caenorhabditis elegans OX=6239 GN=famk-1 PE=1 SV=1
15	Q99N91	7.3	29.3	92	0.034	0.152	RM34_MOUSE Large ribosomal subunit protein bL34m OS=Mus musculus OX=10090 GN=Mrpl34 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15051 FAM198	4.4	17.7	FAM198 protein
2	PF06702 Fam20C	6e-85	295.8	Golgi casein kinase, C-terminal, Fam20
3	PF07804 HipA_C	3.3e+02	12.4	HipA-like C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263733

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261381	0.873	Xylosyltransferase 1
2	9606.ENSP00000283148	0.842	UDP-glucuronic acid decarboxylase 1
3	9606.ENSP00000356607	0.719	Ras-specific guanine nucleotide-releasing factor RalGPS2
4	9606.ENSP00000407301	0.708	Protein FAM198A
5	9606.ENSP00000307674	0.703	Soluble calcium-activated nucleotidase 1
6	9606.ENSP00000377396	0.691	Protein FAM198B
7	9606.ENSP00000265471	0.672	Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3
8	9606.ENSP00000359132	0.672	Exostosin-like 2
9	9606.ENSP00000234816	0.663	Angiopoietin-related protein 1
10	9606.ENSP00000368496	0.661	Beta-1,3-galactosyltransferase 6
11	9606.ENSP00000305974	0.649	Solute carrier organic anion transporter family member 1A2
12	9606.ENSP00000234701	0.648	Calcium-activated chloride channel regulator 1
13	9606.ENSP00000359594	0.648	Calcium-activated chloride channel regulator 4
14	9606.ENSP00000017003	0.647	Xylosyltransferase 2
15	9606.ENSP00000377401	0.608	Adenosine 3'-phospho 5'-phosphosulfate transporter 1
16	9606.ENSP00000313809	0.603	Ameloblastin
17	9606.ENSP00000400223	0.587	Four-jointed box protein 1
18	9606.ENSP00000363590	0.550	Chondroitin sulfate N-acetylgalactosaminyltransferase 2
19	9606.ENSP00000379383	0.548	Enamelin
20	9606.ENSP00000220562	0.533	Exostosin-like 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0016773	0.999	phosphotransferase activity, alcohol group as acceptor
GO:0004672	0.994	protein kinase activity
GO:0004674	0.974	protein serine/threonine kinase activity
GO:0043167	0.885	ion binding
GO:0046872	0.881	metal ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0071704	0.984	organic substance metabolic process
GO:0044238	0.984	primary metabolic process
GO:0044237	0.982	cellular metabolic process
GO:0006807	0.968	nitrogen compound metabolic process
GO:0019538	0.927	protein metabolic process
GO:1901135	0.855	carbohydrate derivative metabolic process
GO:1901576	0.733	organic substance biosynthetic process
GO:0044249	0.730	cellular biosynthetic process
GO:1901137	0.688	carbohydrate derivative biosynthetic process
GO:0009100	0.616	glycoprotein metabolic process
GO:1901566	0.588	organonitrogen compound biosynthetic process
GO:0009101	0.578	glycoprotein biosynthetic process
GO:0006029	0.575	proteoglycan metabolic process
GO:0048856	0.559	anatomical structure development
GO:0030166	0.541	proteoglycan biosynthetic process
GO:0032501	0.442	multicellular organismal process
GO:0007275	0.327	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	0.999	Golgi apparatus
GO:0070013	0.988	intracellular organelle lumen
GO:0031981	0.958	nuclear lumen
GO:0005654	0.949	nucleoplasm
GO:0016020	0.832	membrane
GO:0071944	0.433	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.

[back to server]