StarFunc result for job id O75064

User Input

>input (1496 residues)
MAEERPPRLVDYFVVAGLAGNGAPIPEETWVPEPSGPLRPPRPAEPITDVAVIARALGEE
VPQGYTCIQASAGGHPLELSAGLLGGTQPVICYRRGRDKPPLVELGVLYEGKERPKPGFQ
VLDTTPYSHSANLAPPGPGHPRTYLTYRRAAEGAGLHALGITDLCLVLPSKGEGTPHTYC
RLPRNLNPGMWGPAVYLCYKVGLAKANTLVYEAELLGRYPEEDNEAFPLPESVPVFCLPM
GATIECWPAQTKYPVPVFSTFVLTGAAGDKVYGAALQFYEAFPRARLSERQARALGLLSA
VERGRALGGRAVRSRRAIAVLSRWPAFPAFRAFLTFLYRYSVSGPHRLPLEAHISHFIHN
VPFPSPQRPRILVQMSPYDNLLLCQPVSSPLPLSGASFLQLLQSLGPELAITLLLAVLTE
HKLLVHSLRPDLLTSVCEALVSMIFPLHWQCPYIPLCPLVLADVLSAPVPFIVGIHSSYF
DLHDPPADVICVDLDTNTLFQTEEKKLLSPRTLPRRPYKVLLATLTNLYQQLDQTYTGPE
EEASLEFLLTDYEAVCGRRARLEREVQGAFLRFMACLLKGYRVFLRPLTQAPSEGARDVD
NLFFLQGFLKSRERSSHKLYSQLLHTQMFSQFIEECSFGSARHAALEFFDSCVEKVHPEQ
EKPEPTPLVELEELSGSELTVFITPPEEPALPEGSESTPQYCYDGFPELRAELFESLQEQ
PGALPVPGPSRSAPSSPAPRRTKQEMKVAQRMAQKSAAVPELWARCLLGHCYGLWFLCLP
AYVRSAPSRVQALHTAYHVLRQMESGKVVLPDEVCYRVLMQLCSHYGQPVLSVRVMLEMR
QAGIVPNTITYGYYNKAVLESKWPSGTPGGRLRWAKLRNVVLGAAQFRQPLRERQQQQQQ
QQQQQQQQQQEQVSAHQEAGSSQAEPYLERPSPTRPLQRQTTWAGRSLRDPASPPGRLVK
SGSLGSARGAQPTVEAGVAHMIEALGVLEPRGSPVPWHDGSLSDLSLTGEEPLPGGSPGG
SGSALSAQSTEALEGLSGRGPKAGGRQDEAGTPRRGLGARLQQLLTPSRHSPASRIPPPE
LPPDLPPPARRSPMDSLLHPRERPGSTASESSASLGSEWDLSESSLSNLSLRRSSERLSD
TPGSFQSPSLEILLSSCSLCRACDSLVYDEEIMAGWAPDDSNLNTTCPFCACPFVPLLSV
QTLDSRPSVPSPKSAGASGSKDAPVPGGPGPVLSDRRLCLALDEPQLCNGHMGGASRRVE
SGAWAYLSPLVLRKELESLVENEGSEVLALPELPSAHPIIFWNLLWYFQRLRLPSILPGL
VLASCDGPSHSQAPSPWLTPDPASVQVRLLWDVLTPDPNSCPPLYVLWRVHSQIPQRVVW
PGPVPASLSLALLESVLRHVGLNEVHKAVGLLLETLGPPPTGLHLQRGIYREILFLTMAA
LGKDHVDIVAFDKKYKSAFNKLASSMGKEELRHRRAQMPTPKAIDCRKCFGAPPEC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75064	1.000	1.000	0.000	1496	1.000	1.000	O75064.pdb.gz	DEN4B_HUMAN DENN domain-containing protein 4B OS=Homo sapiens OX=9606 GN=DENND4B PE=1 SV=4
2	PDB:6nzdH	0.069	0.223	2.146E-3	387	0.034	0.132	6nzdH.pdb.gz	Structural mechanism of a Rag GTPase activation checkpoint by the lysosomal folliculin complex.
3	PDB:8dhbJ	0.069	0.245	1.595E-2	361	0.030	0.125	8dhbJ.pdb.gz	Structural basis for FLCN RagC GAP activation in MiT-TFE substrate-selective mTORC1 regulation.
4	PDB:6lt0B	0.062	0.183	3.665E-2	386	0.021	0.083	6lt0B.pdb.gz
5	PDB:6ulgL	0.088	0.228	4.042E-2	458	0.041	0.135	6ulgL.pdb.gz	Cryo-EM Structure of the Human FLCN-FNIP2-Rag-Ragulator Complex.
6	PDB:3fcsA	0.032	0.044	1.186E-1	913	0.027	0.044	3fcsA.pdb.gz	Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
7	PDB:7mgeB	0.058	0.163	1.186E-1	442	0.019	0.066	7mgeB.pdb.gz	Structural basis for the ARF GAP activity and specificity of the C9orf72 complex.
8	PDB:7o2wB	0.066	0.192	2.595E-1	422	0.017	0.059	7o2wB.pdb.gz
9	PDB:6lt0C	0.060	0.164	5.148E-1	385	0.024	0.094	6lt0C.pdb.gz
10	AFDB:P48415	0.044	0.032	8.306E-1	2195	0.058	0.040	P48415.pdb.gz	SEC16_YEAST COPII coat assembly protein SEC16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC16 PE=1 SV=2
11	PDB:6u2lA	0.053	0.113	9.726E-1	613	0.025	0.060	6u2lA.pdb.gz
12	AFDB:Q9FUY2	0.040	0.059	1.170	931	0.059	0.095	Q9FUY2.pdb.gz	LEUNG_ARATH Transcriptional corepressor LEUNIG OS=Arabidopsis thaliana OX=3702 GN=LUG PE=1 SV=2
13	PDB:4v60A	0.048	0.065	1.242	812	0.027	0.049	4v60A.pdb.gz
14	AFDB:Q98SV4	0.037	0.061	1.908	816	0.053	0.097	Q98SV4.pdb.gz	Q98SV4_ICTPU Delayed rectifier potassium channel Kv2 OS=Ictalurus punctatus OX=7998 GN=kcnb2b PE=2 SV=1
15	AFDB:A0A0R4IF44	0.051	0.045	2.004	1792	0.109	0.091	A0A0R4IF44.pdb.gz
16	AFDB:D4AD99	0.029	0.050	2.437	756	0.061	0.120	D4AD99.pdb.gz	D4AD99_RAT Cytoplasmic polyadenylation element binding protein 3 OS=Rattus norvegicus OX=10116 GN=Cpeb3 PE=1 SV=3
17	AFDB:O94988	0.042	0.052	3.113	1023	0.071	0.104	O94988.pdb.gz	FA13A_HUMAN Protein FAM13A OS=Homo sapiens OX=9606 GN=FAM13A PE=1 SV=2
18	AFDB:O13870	0.031	0.054	3.605	640	0.038	0.089	O13870.pdb.gz	NOT3_SCHPO General negative regulator of transcription subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=not3 PE=1 SV=2
19	AFDB:Q5TZH9	0.031	0.042	3.786	841	0.066	0.117	Q5TZH9.pdb.gz	Q5TZH9_DANRE Inner nuclear membrane protein Man1 OS=Danio rerio OX=7955 GN=im:7158446 PE=1 SV=1
20	AFDB:O60566	0.042	0.058	5.077	1050	0.038	0.054	O60566.pdb.gz	BUB1B_HUMAN Mitotic checkpoint serine/threonine-protein kinase BUB1 beta OS=Homo sapiens OX=9606 GN=BUB1B PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6H8H2	0.0	950	1906	0.320	0.251	DEN4C_MOUSE DENN domain-containing protein 4C OS=Mus musculus OX=10090 GN=Dennd4c PE=1 SV=1
2	O75064	0.0	3008	1496	1.000	1.000	DEN4B_HUMAN DENN domain-containing protein 4B OS=Homo sapiens OX=9606 GN=DENND4B PE=1 SV=4
3	Q5VZ89	0.0	967	1909	0.327	0.256	DEN4C_HUMAN DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C PE=1 SV=3
4	Q7Z401	0.0	1066	1863	0.342	0.275	MYCPP_HUMAN C-myc promoter-binding protein OS=Homo sapiens OX=9606 GN=DENND4A PE=1 SV=2
5	Q9W3D3	0.0	671	1671	0.259	0.232	CRAG_DROME DENN domain-containing protein Crag OS=Drosophila melanogaster OX=7227 GN=Crag PE=1 SV=3
6	X6R5W5	1.22e-44	176	696	0.066	0.141	X6R5W5_HUMAN DENN domain containing 4C (Fragment) OS=Homo sapiens OX=9606 GN=DENND4C PE=1 SV=1
7	Q86WG5	1.92e-34	147	1849	0.088	0.071	MTMRD_HUMAN Myotubularin-related protein 13 OS=Homo sapiens OX=9606 GN=SBF2 PE=1 SV=1
8	E9PXF8	2.47e-34	146	1872	0.088	0.071	MTMRD_MOUSE Myotubularin-related protein 13 OS=Mus musculus OX=10090 GN=Sbf2 PE=1 SV=1
9	Q7KSP6	5.45e-29	129	1973	0.084	0.063	Q7KSP6_DROME SET domain binding factor, isoform B OS=Drosophila melanogaster OX=7227 GN=Sbf PE=1 SV=1
10	Q9VGH9	7.35e-29	129	1993	0.084	0.063	Q9VGH9_DROME SET domain binding factor, isoform A OS=Drosophila melanogaster OX=7227 GN=Sbf PE=1 SV=3
11	M0RAP5	1.96e-27	124	1893	0.079	0.062	M0RAP5_RAT SET binding factor 1 OS=Rattus norvegicus OX=10116 GN=Sbf1 PE=1 SV=1
12	Q6ZPE2	2.03e-27	124	1867	0.081	0.065	MTMR5_MOUSE Myotubularin-related protein 5 OS=Mus musculus OX=10090 GN=Sbf1 PE=1 SV=2
13	X6RAE7	7.85e-27	121	881	0.047	0.081	X6RAE7_HUMAN DENN domain containing 4C (Fragment) OS=Homo sapiens OX=9606 GN=DENND4C PE=1 SV=1
14	A0A8I6AD51	1.03e-26	122	1875	0.080	0.064	A0A8I6AD51_RAT SET binding factor 1 OS=Rattus norvegicus OX=10116 GN=Sbf1 PE=1 SV=1
15	Q8RXA7	6.89e-26	119	1187	0.089	0.112	SCD1_ARATH DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana OX=3702 GN=SCD1 PE=1 SV=1
16	O95248	7.57e-26	119	1868	0.076	0.061	MTMR5_HUMAN Myotubularin-related protein 5 OS=Homo sapiens OX=9606 GN=SBF1 PE=1 SV=4
17	O02626	2.24e-23	110	1409	0.059	0.062	MADD_CAEEL MAP kinase-activating death domain protein OS=Caenorhabditis elegans OX=6239 GN=aex-3 PE=1 SV=1
18	G3V7Q0	9.01e-21	102	1287	0.057	0.067	DEN5A_RAT DENN domain-containing protein 5A OS=Rattus norvegicus OX=10116 GN=Dennd5a PE=2 SV=1
19	Q6PAL8	9.01e-21	102	1287	0.057	0.067	DEN5A_MOUSE DENN domain-containing protein 5A OS=Mus musculus OX=10090 GN=Dennd5a PE=1 SV=1
20	Q6ZUT9	2.63e-20	100	1274	0.052	0.061	DEN5B_HUMAN DENN domain-containing protein 5B OS=Homo sapiens OX=9606 GN=DENND5B PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03455 dDENN	8.3e-08	43.5	dDENN domain
2	PF02141 DENN	1.7e-54	196.1	DENN (AEX-3) domain
3	PF13041 PPR_2	1.9	20.0	PPR repeat family
4	PF13812 PPR_3	1.5e+02	13.8	Pentatricopeptide repeat domain
5	PF17177 PPR_long	4	18.2	Pentacotripeptide-repeat region of PRORP
6	PF08616 SPA	14	17.1	Stabilization of polarity axis
7	PF12090 Spt20	2.1e+02	13.0	Spt20 family
8	PF16619 SUIM_assoc	29	16.0	Unstructured region C-term to UIM in Ataxin3
9	PF03456 uDENN	1.1e-13	62.7	uDENN domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354597

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264710	0.944	Ras-related protein Rab-10
2	9606.ENSP00000369538	0.902	Rab GDP dissociation inhibitor beta
3	9606.ENSP00000394071	0.902	Rab GDP dissociation inhibitor alpha
4	9606.ENSP00000350386	0.900	Rab proteins geranylgeranyltransferase component A 1
5	9606.ENSP00000355511	0.900	Rab proteins geranylgeranyltransferase component A 2
6	9606.ENSP00000357612	0.646	Zinc transporter ZIP1
7	9606.ENSP00000320794	0.625	Basic helix-loop-helix domain-containing protein USF3
8	9606.ENSP00000355011	0.615	Interleukin enhancer-binding factor 2
9	9606.ENSP00000357622	0.599	CREB-regulated transcription coactivator 2
10	9606.ENSP00000414517	0.599	Mastermind-like domain-containing protein 1
11	9606.ENSP00000288462	0.590	Uncharacterized protein C9orf43
12	9606.ENSP00000263205	0.560	Mediator of RNA polymerase II transcription subunit 15
13	9606.ENSP00000439856	0.551	Calcium homeostasis endoplasmic reticulum protein
14	9606.ENSP00000243298	0.523	Ras-related protein Rab-9B
15	9606.ENSP00000328017	0.520	KRAB-A domain containing 2
16	9606.ENSP00000440674	0.512	Polyhomeotic-like protein 1
17	9606.ENSP00000280665	0.506	mRNA-decapping enzyme 1B
18	9606.ENSP00000310933	0.503	MAP kinase-activating death domain protein
19	9606.ENSP00000315568	0.503	Late secretory pathway protein AVL9 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0005488	0.903	binding
GO:0005515	0.760	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0051056	0.971	regulation of small GTPase mediated signal transduction
GO:0046578	0.915	regulation of Ras protein signal transduction
GO:0009987	0.778	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005829	1.000	cytosol
GO:0005654	0.995	nucleoplasm
GO:0005794	0.973	Golgi apparatus
GO:0016020	0.674	membrane
GO:0031090	0.378	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]