StarFunc result for job id O75074

User Input

>input (770 residues)
MEKRAAAGLEGAPGARAQLAVVCLVNIFLTGRLSSAVPALAACSGKLEQHTERRGVIYSP
AWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLDWLLLGPAAPPRQEAFRLC
GSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQASCQADEFRCDNGKCLP
GPWQCNTVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCLPVERRCDGLQDC
GDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDSRRVLLQLEL
RLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFNA
TYQVKGYCLPWEQPCGSSSDSDGGSLGDQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQ
YPCEGGSGLCYTPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDC
QDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRL
EAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPS
RRRLGRLWNRLFHRPRAPRGQIPLLTAARPSQTVLGDGFLQPAPGAAPDPPAPLMDTGST
RAAGDRPPSAPGRAPEVGPSGPPLPSGLRDPECRPVDKDRKVCREPLVDGPAPADAPREP
CSAQDPHPQVSTASSTLGPHSPEPLGVCRNPPPPCSPMLEASDDEALLVC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75074	1.000	1.000	0.000	770	1.000	1.000	O75074.pdb.gz	LRP3_HUMAN Low-density lipoprotein receptor-related protein 3 OS=Homo sapiens OX=9606 GN=LRP3 PE=2 SV=2
2	AFDB:Q9Y561	0.310	0.285	1.707E-71	859	0.419	0.376	Q9Y561.pdb.gz	LRP12_HUMAN Low-density lipoprotein receptor-related protein 12 OS=Homo sapiens OX=9606 GN=LRP12 PE=1 SV=1
3	PDB:7b01A	0.112	0.144	1.111E-8	588	0.058	0.077	7b01A.pdb.gz	Crystal structure of ADAMTS13 CUB domains reveals their role in global latency.
4	AFDB:A0A0R4IL75	0.083	0.070	4.275E-8	935	0.109	0.090	A0A0R4IL75.pdb.gz
5	AFDB:O75096	0.090	0.041	1.258E-7	1905	0.108	0.044	O75096.pdb.gz	LRP4_HUMAN Low-density lipoprotein receptor-related protein 4 OS=Homo sapiens OX=9606 GN=LRP4 PE=1 SV=4
6	PDB:1fxzA	0.081	0.151	1.898E-5	371	0.049	0.102	1fxzA.pdb.gz
7	PDB:3fz3A	0.071	0.110	2.522E-5	388	0.048	0.095	3fz3A.pdb.gz	Crystal structure of prunin-1, a major component of the almond (Prunus dulcis) allergen amandin.
8	PDB:3lxuX	0.111	0.076	3.547E-5	1217	0.038	0.024	3lxuX.pdb.gz
9	PDB:6l4cC	0.092	0.159	8.318E-5	353	0.034	0.074	6l4cC.pdb.gz	Comparative study of 7S globulin from Corylus avellana and Solanum lycopersicum revealed importance of salicylic acid and Cu-binding loop in modulating their function.
10	PDB:1uijC	0.085	0.167	1.170E-4	346	0.029	0.064	1uijC.pdb.gz
11	AFDB:Q54XS3	0.107	0.059	1.219E-4	1661	0.082	0.038	Q54XS3.pdb.gz	GDT1_DICDI Probable inactive serine/threonine-protein kinase gdt1 OS=Dictyostelium discoideum OX=44689 GN=gdt1 PE=1 SV=1
12	PDB:1ipkC	0.078	0.145	1.468E-4	379	0.030	0.061	1ipkC.pdb.gz
13	PDB:4nhyA	0.085	0.130	2.065E-4	461	0.058	0.098	4nhyA.pdb.gz	Structure of the Ribosomal Oxygenase OGFOD1 Provides Insights into the Regio- and Stereoselectivity of Prolyl Hydroxylases.
14	PDB:5eiyB	0.094	0.106	2.592E-4	658	0.051	0.059	5eiyB.pdb.gz	Observing cellulose biosynthesis and membrane translocation in crystallo.
15	PDB:4zelA	0.107	0.142	3.444E-4	550	0.051	0.071	4zelA.pdb.gz	The crystal structure of human dopamine beta-hydroxylase at 2.9 angstrom resolution.
16	AFDB:Q52KB6	0.074	0.029	2.477E-3	2323	0.142	0.047	Q52KB6.pdb.gz	C2CD3_MOUSE C2 domain-containing protein 3 OS=Mus musculus OX=10090 GN=C2cd3 PE=1 SV=3
17	AFDB:Q93ZG9	0.088	0.133	2.622E-3	477	0.077	0.124	Q93ZG9.pdb.gz	FKB53_ARATH Peptidyl-prolyl cis-trans isomerase FKBP53 OS=Arabidopsis thaliana OX=3702 GN=FKBP53 PE=1 SV=1
18	AFDB:P43146	0.069	0.041	1.526E-2	1447	0.129	0.068	P43146.pdb.gz	DCC_HUMAN Netrin receptor DCC OS=Homo sapiens OX=9606 GN=DCC PE=1 SV=2
19	AFDB:Q9H252	0.059	0.048	2.851E-2	994	0.097	0.075	Q9H252.pdb.gz	KCNH6_HUMAN Potassium voltage-gated channel subfamily H member 6 OS=Homo sapiens OX=9606 GN=KCNH6 PE=1 SV=1
20	AFDB:A0A2R8QL08	0.099	0.049	8.393E-2	2036	0.114	0.043	A0A2R8QL08.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9Q1T6	0.0	1382	790	0.931	0.908	E9Q1T6_MOUSE Low density lipoprotein receptor-related protein 3 OS=Mus musculus OX=10090 GN=Lrp3 PE=4 SV=1
2	E9Q711	0.0	1392	769	0.931	0.932	E9Q711_MOUSE Low density lipoprotein receptor-related protein 3 OS=Mus musculus OX=10090 GN=Lrp3 PE=4 SV=1
3	O75074	0.0	1553	770	1.000	1.000	LRP3_HUMAN Low-density lipoprotein receptor-related protein 3 OS=Homo sapiens OX=9606 GN=LRP3 PE=2 SV=2
4	Q3UEU3	0.0	1136	638	0.730	0.881	Q3UEU3_MOUSE CUB domain-containing protein OS=Mus musculus OX=10090 GN=Lrp3 PE=2 SV=1
5	Q3UEV4	0.0	1350	770	0.908	0.908	Q3UEV4_MOUSE CUB domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Lrp3 PE=2 SV=1
6	Q8BUJ9	0.0	588	858	0.401	0.360	LRP12_MOUSE Low-density lipoprotein receptor-related protein 12 OS=Mus musculus OX=10090 GN=Lrp12 PE=2 SV=2
7	Q9Y561	0.0	591	859	0.397	0.356	LRP12_HUMAN Low-density lipoprotein receptor-related protein 12 OS=Homo sapiens OX=9606 GN=LRP12 PE=1 SV=1
8	Q7TQH7	3.63e-129	403	713	0.306	0.331	LRP10_MOUSE Low-density lipoprotein receptor-related protein 10 OS=Mus musculus OX=10090 GN=Lrp10 PE=2 SV=2
9	Q7Z4F1	1.46e-127	399	713	0.304	0.328	LRP10_HUMAN Low-density lipoprotein receptor-related protein 10 OS=Homo sapiens OX=9606 GN=LRP10 PE=1 SV=2
10	Q52KH0	1.69e-108	332	234	0.256	0.842	Q52KH0_MOUSE Lrp3 protein OS=Mus musculus OX=10090 GN=Lrp3 PE=2 SV=1
11	A0A8I6AEJ8	1.25e-26	119	820	0.101	0.095	A0A8I6AEJ8_RAT ST14 transmembrane serine protease matriptase OS=Rattus norvegicus OX=10116 GN=St14 PE=4 SV=1
12	F1QRG7	4.84e-26	115	572	0.142	0.191	F1QRG7_DANRE Membrane frizzled-related protein OS=Danio rerio OX=7955 GN=si:cabz01033205.3 PE=4 SV=2
13	Q9JJI7	6.17e-23	107	855	0.109	0.098	Q9JJI7_RAT Suppressor of tumorigenicity 14 protein homolog OS=Rattus norvegicus OX=10116 GN=St14 PE=1 SV=1
14	A0A8I6ARC9	6.65e-23	107	846	0.109	0.099	A0A8I6ARC9_RAT Suppressor of tumorigenicity 14 protein homolog OS=Rattus norvegicus OX=10116 GN=St14 PE=3 SV=1
15	Q9BY79	3.07e-22	103	579	0.140	0.187	MFRP_HUMAN Membrane frizzled-related protein OS=Homo sapiens OX=9606 GN=MFRP PE=1 SV=1
16	P56677	5.81e-22	103	855	0.106	0.096	ST14_MOUSE Suppressor of tumorigenicity 14 protein homolog OS=Mus musculus OX=10090 GN=St14 PE=1 SV=2
17	X2JE09	5.87e-22	104	3973	0.125	0.024	X2JE09_DROME Terribly reduced optic lobes, isoform AV OS=Drosophila melanogaster OX=7227 GN=trol PE=1 SV=1
18	M9NGL3	6.56e-22	104	3967	0.125	0.024	M9NGL3_DROME Terribly reduced optic lobes, isoform AM OS=Drosophila melanogaster OX=7227 GN=trol PE=1 SV=2
19	Q8IRV9	6.80e-22	104	4007	0.125	0.024	Q8IRV9_DROME Terribly reduced optic lobes, isoform AW OS=Drosophila melanogaster OX=7227 GN=trol PE=1 SV=3
20	Q8IRV7	1.05e-21	103	3105	0.125	0.031	Q8IRV7_DROME Terribly reduced optic lobes, isoform AG OS=Drosophila melanogaster OX=7227 GN=trol PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00431 CUB	3e-24	96.8	CUB domain
2	PF00057 Ldl_recept_a	2.3e-32	122.2	Low-density lipoprotein receptor domain class A

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000253193

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000398688	0.783	Von Willebrand factor A domain containing 5B2
2	9606.ENSP00000311962	0.777	ADP-ribosylation factor-binding protein GGA2
3	9606.ENSP00000341344	0.754	ADP-ribosylation factor-binding protein GGA1
4	9606.ENSP00000421922	0.745	Alpha-2-macroglobulin receptor-associated protein
5	9606.ENSP00000355470	0.725	Consortin
6	9606.ENSP00000376188	0.699	Cytokine receptor-like factor 1
7	9606.ENSP00000438085	0.695	ADP-ribosylation factor-binding protein GGA3
8	9606.ENSP00000260327	0.611	CTD small phosphatase-like protein 2
9	9606.ENSP00000266529	0.604	Zinc finger CCHC-type and RNA binding motif containing 1
10	9606.ENSP00000365162	0.525	Myosin light chain kinase 2, skeletal/cardiac muscle
11	9606.ENSP00000340988	0.517	Low density lipoprotein receptor class A domain containing 2
12	9606.ENSP00000342848	0.511	NADPH oxidase activator 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.988	regulation of biological process
GO:0050794	0.980	regulation of cellular process
GO:0051179	0.957	localization
GO:0006810	0.954	transport
GO:0048518	0.932	positive regulation of biological process
GO:0048522	0.901	positive regulation of cellular process
GO:0006897	0.881	endocytosis
GO:0019222	0.808	regulation of metabolic process
GO:0048519	0.794	negative regulation of biological process
GO:0048523	0.758	negative regulation of cellular process
GO:0006898	0.726	receptor-mediated endocytosis
GO:0060255	0.711	regulation of macromolecule metabolic process
GO:0009987	0.693	cellular process
GO:0045667	0.660	regulation of osteoblast differentiation
GO:0051093	0.544	negative regulation of developmental process
GO:0045598	0.527	regulation of fat cell differentiation
GO:0045669	0.458	positive regulation of osteoblast differentiation
GO:0045599	0.449	negative regulation of fat cell differentiation
GO:0008152	0.414	metabolic process
GO:0010468	0.385	regulation of gene expression
GO:0010604	0.348	positive regulation of macromolecule metabolic process
GO:0071704	0.334	organic substance metabolic process
GO:0009892	0.315	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0071944	0.939	cell periphery
GO:0005622	0.825	intracellular anatomical structure
GO:0005737	0.809	cytoplasm
GO:0005886	0.662	plasma membrane
GO:0043231	0.485	intracellular membrane-bounded organelle
GO:0012505	0.323	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]