StarFunc result for job id O75081

User Input

>input (653 residues)
MPASRLRDRAASSASGSTCGSMSQTHPVLESGLLASAGCSAPRGPRKGGPAPVDRKAKAS
AMPDSPAEVKTQPRSTPPSMPPPPPAASQGATRPPSFTPHTHREDGPATLPHGRFHGCLK
WSMVCLLMNGSSHSPTAINGAPCTPNGFSNGPATSSTASLSTQHLPPACGARQLSKLKRF
LTTLQQFGSDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANL
PLLQRELLHCARLAKQTPAQYLAQHEQLLLDASASSPIDSSELLLEVNENGKRRTPDRTK
ENGSDRDPLHPEHLSKRPCTLNPAQRYSPSNGPPQPTPPPHYRLEDIAMAHHFRDAYRHP
DPRELRERHRPLVVPGSRQEEVIDHKLTEREWAEEWKHLNNLLNCIMDMVEKTRRSLTVL
RRCQEADREELNHWARRYSDAEDTKKGPAPAAARPRSSSAGPEGPQLDVPREFLPRTLTG
YVPEDIWRKAEEAVNEVKRQAMSELQKAVSDAERKAHELITTERAKMERALAEAKRQASE
DALTVINQQEDSSESCWNCGRKASETCSGCNAARYCGSFCQHRDWEKHHHVCGQSLQGPT
AVVADPVPGPPEAAHSLGPSLPVGAASPSEAGSAGPSRPGSPSPPGPLDTVPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75081	1.000	1.000	2.399E-88	653	1.000	1.000	O75081.pdb.gz	MTG16_HUMAN Protein CBFA2T3 OS=Homo sapiens OX=9606 GN=CBFA2T3 PE=1 SV=2
2	AFDB:A0A0A0MSU1	0.263	0.260	1.476E-57	663	0.666	0.656	A0A0A0MSU1.pdb.gz	A0A0A0MSU1_HUMAN RUNX1 partner transcriptional co-repressor 1 OS=Homo sapiens OX=9606 GN=RUNX1T1 PE=1 SV=1
3	AFDB:O61707	0.146	0.178	5.620E-5	523	0.165	0.207	O61707.pdb.gz	TAF4_CAEEL Transcription initiation factor TFIID subunit 4 OS=Caenorhabditis elegans OX=6239 GN=taf-4 PE=1 SV=2
4	AFDB:Q7JQG5	0.074	0.056	1.619E-4	924	0.115	0.081	Q7JQG5.pdb.gz	Q7JQG5_DROME Caskin, isoform B OS=Drosophila melanogaster OX=7227 GN=ckn PE=2 SV=1
5	AFDB:A0A087WYS3	0.120	0.078	2.391E-4	1087	0.142	0.086	A0A087WYS3.pdb.gz	A0A087WYS3_HUMAN Zinc finger MYND-type containing 8 OS=Homo sapiens OX=9606 GN=ZMYND8 PE=1 SV=1
6	AFDB:O44757	0.066	0.039	3.159E-4	1312	0.124	0.062	O44757.pdb.gz	LIN59_CAEEL Probable histone-lysine N-methyltransferase lin-59 OS=Caenorhabditis elegans OX=6239 GN=lin-59 PE=2 SV=1
7	AFDB:G5E8Z2	0.139	0.108	1.679E-3	850	0.124	0.095	G5E8Z2.pdb.gz	TAF4B_MOUSE Transcription initiation factor TFIID subunit 4B OS=Mus musculus OX=10090 GN=Taf4b PE=1 SV=2
8	AFDB:A0A087WVZ6	0.128	0.080	2.480E-3	1136	0.150	0.086	A0A087WVZ6.pdb.gz	A0A087WVZ6_HUMAN Zinc finger MYND-type containing 8 OS=Homo sapiens OX=9606 GN=ZMYND8 PE=1 SV=2
9	AFDB:P14164	0.073	0.067	3.463E-3	731	0.092	0.082	P14164.pdb.gz	ABF1_YEAST ARS-binding factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ABF1 PE=1 SV=4
10	AFDB:E2QD16	0.090	0.049	8.443E-3	1570	0.168	0.070	E2QD16.pdb.gz	E2QD16_DROME Non-specific lethal 1, isoform M OS=Drosophila melanogaster OX=7227 GN=nsl1 PE=1 SV=1
11	PDB:5v3hA	0.066	0.097	2.670E-1	438	0.020	0.030	5v3hA.pdb.gz	Small molecule inhibitors and CRISPR/Cas9 mutagenesis demonstrate that SMYD2 and SMYD3 activity are dispensable for autonomous cancer cell proliferation.
12	PDB:7mq8LT	0.066	0.054	6.881E-1	869	0.040	0.030	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:3n71A	0.057	0.079	9.090E-1	468	0.018	0.026	3n71A.pdb.gz	Crystal Structure of Cardiac-specific Histone Methyltransferase SmyD1 Reveals Unusual Active Site Architecture.
14	PDB:5ex0A	0.062	0.092	1.270	429	0.021	0.033	5ex0A.pdb.gz	Structural Basis for Substrate Preference of SMYD3, a SET Domain-containing Protein Lysine Methyltransferase
15	PDB:2jmhA	0.068	0.224	2.216	117	0.025	0.137	2jmhA.pdb.gz
16	PDB:6qw65B	0.087	0.034	2.477	2001	0.038	0.012	6qw65B.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
17	PDB:7rro2	0.061	0.112	2.769	292	0.021	0.048	7rro2.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
18	PDB:4k80A	0.058	0.134	2.927	209	0.028	0.086	4k80A.pdb.gz	Non-vesicular trafficking by a ceramide-1-phosphate transfer protein regulates eicosanoids.
19	PDB:6vvoE	0.068	0.106	3.095	346	0.023	0.043	6vvoE.pdb.gz	Structure of the human clamp loader bound to the sliding clamp: a further twist on AAA+ mechanism
20	PDB:5xjt2	0.078	0.169	3.272	217	0.038	0.115	5xjt2.pdb.gz	Structures of 7S mutant complexes

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MSU1	0.0	806	663	0.654	0.644	A0A0A0MSU1_HUMAN RUNX1 partner transcriptional co-repressor 1 OS=Homo sapiens OX=9606 GN=RUNX1T1 PE=1 SV=1
2	H3BNH2	0.0	832	418	0.622	0.971	H3BNH2_HUMAN CBFA2/RUNX1 partner transcriptional co-repressor 3 (Fragment) OS=Homo sapiens OX=9606 GN=CBFA2T3 PE=1 SV=8
3	O43439	0.0	650	604	0.525	0.568	MTG8R_HUMAN Protein CBFA2T2 OS=Homo sapiens OX=9606 GN=CBFA2T2 PE=1 SV=1
4	O54972	0.0	1045	620	0.842	0.887	MTG16_MOUSE Protein CBFA2T3 OS=Mus musculus OX=10090 GN=Cbfa2t3 PE=1 SV=2
5	O70374	0.0	648	594	0.513	0.564	MTG8R_MOUSE Protein CBFA2T2 OS=Mus musculus OX=10090 GN=Cbfa2t2 PE=1 SV=3
6	O75081	0.0	1329	653	1.000	1.000	MTG16_HUMAN Protein CBFA2T3 OS=Homo sapiens OX=9606 GN=CBFA2T3 PE=1 SV=2
7	Q06455	0.0	810	604	0.654	0.707	MTG8_HUMAN Protein CBFA2T1 OS=Homo sapiens OX=9606 GN=RUNX1T1 PE=1 SV=2
8	Q61909	0.0	809	577	0.655	0.742	MTG8_MOUSE Protein CBFA2T1 OS=Mus musculus OX=10090 GN=Runx1t1 PE=2 SV=1
9	Q9IAB2	0.0	619	586	0.508	0.567	MTG8R_XENLA Protein CBFA2T2 OS=Xenopus laevis OX=8355 GN=cbfa2t2 PE=2 SV=2
10	W8FW32	0.0	803	567	0.648	0.746	W8FW32_HUMAN CBFA2T1 isoform r1t1-7d56 OS=Homo sapiens OX=9606 GN=RUNX1T1 PE=2 SV=1
11	H3BSI4	5.00e-87	269	132	0.202	1.000	H3BSI4_HUMAN CBFA2/RUNX1 partner transcriptional co-repressor 3 (Fragment) OS=Homo sapiens OX=9606 GN=CBFA2T3 PE=1 SV=1
12	H3BNI7	1.07e-75	240	130	0.199	1.000	H3BNI7_HUMAN CBFA2/RUNX1 partner transcriptional co-repressor 3 (Fragment) OS=Homo sapiens OX=9606 GN=CBFA2T3 PE=1 SV=1
13	Q24037	8.42e-64	226	743	0.239	0.210	Q24037_DROME Nervy OS=Drosophila melanogaster OX=7227 GN=nvy PE=2 SV=1
14	A0A0B4KFZ8	2.09e-63	225	742	0.239	0.210	A0A0B4KFZ8_DROME Nervy, isoform B OS=Drosophila melanogaster OX=7227 GN=nvy PE=4 SV=1
15	Q9W186	2.21e-63	225	743	0.239	0.210	Q9W186_DROME LD17501p OS=Drosophila melanogaster OX=7227 GN=nvy PE=2 SV=2
16	A0A0B4KEZ2	3.55e-63	225	757	0.239	0.206	A0A0B4KEZ2_DROME Nervy, isoform D OS=Drosophila melanogaster OX=7227 GN=nvy PE=4 SV=1
17	Q9Z1T5	7.46e-14	77.0	566	0.064	0.074	DEAF1_MOUSE Deformed epidermal autoregulatory factor 1 homolog OS=Mus musculus OX=10090 GN=Deaf1 PE=1 SV=1
18	O88450	8.48e-14	77.0	565	0.064	0.074	DEAF1_RAT Deformed epidermal autoregulatory factor 1 homolog OS=Rattus norvegicus OX=10116 GN=Deaf1 PE=1 SV=1
19	O75398	6.88e-13	73.9	565	0.060	0.069	DEAF1_HUMAN Deformed epidermal autoregulatory factor 1 homolog OS=Homo sapiens OX=9606 GN=DEAF1 PE=1 SV=1
20	O61707	1.78e-04	47.0	523	0.038	0.048	TAF4_CAEEL Transcription initiation factor TFIID subunit 4 OS=Caenorhabditis elegans OX=6239 GN=taf-4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10153 Efg1	30	16.4	rRNA-processing protein Efg1
2	PF08788 NHR2	4.4e-33	124.1	NHR2 domain like
3	PF07531 TAFH	1.6e-31	119.5	NHR1 homology to TAF
4	PF01753 zf-MYND	0.0022	29.4	MYND finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000268679

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000294339	0.977	T-cell acute lymphocytic leukemia protein 1
2	9606.ENSP00000342235	0.967	Receptor tyrosine-protein kinase erbB-4
3	9606.ENSP00000268712	0.950	Nuclear receptor corepressor 1
4	9606.ENSP00000362649	0.940	Histone deacetylase 1
5	9606.ENSP00000354686	0.927	Zinc finger protein 652
6	9606.ENSP00000392466	0.881	LIM domain-binding protein 1
7	9606.ENSP00000365858	0.859	Erythroid transcription factor
8	9606.ENSP00000381382	0.840	Transcription factor 4
9	9606.ENSP00000300305	0.807	Runt-related transcription factor 1
10	9606.ENSP00000344782	0.749	Zinc finger protein Gfi-1b
11	9606.ENSP00000262366	0.738	Zinc finger protein GLIS2
12	9606.ENSP00000262965	0.725	Transcription factor E2-alpha
13	9606.ENSP00000232974	0.715	Zinc finger and BTB domain-containing protein 47
14	9606.ENSP00000306772	0.711	LIM domain-binding protein 2
15	9606.ENSP00000388940	0.709	Transcription factor 12
16	9606.ENSP00000262653	0.698	Protein CBFA2T2
17	9606.ENSP00000257818	0.672	Rhombotin-2
18	9606.ENSP00000227163	0.666	Transcription factor PU.1
19	9606.ENSP00000269701	0.665	A-kinase anchor protein 8
20	9606.ENSP00000327468	0.646	Kelch domain-containing protein 8B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003714	1.000	transcription corepressor activity
GO:0003682	0.542	chromatin binding
GO:0008134	0.316	transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.995	regulation of primary metabolic process
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0051171	0.995	regulation of nitrogen compound metabolic process
GO:0031323	0.995	regulation of cellular metabolic process
GO:0048523	0.990	negative regulation of cellular process
GO:0006355	0.990	regulation of DNA-templated transcription
GO:0010605	0.952	negative regulation of macromolecule metabolic process
GO:0009987	0.942	cellular process
GO:1903507	0.935	negative regulation of nucleic acid-templated transcription
GO:0045892	0.932	negative regulation of DNA-templated transcription
GO:0048518	0.842	positive regulation of biological process
GO:0032502	0.798	developmental process
GO:0048522	0.797	positive regulation of cellular process
GO:0006357	0.739	regulation of transcription by RNA polymerase II
GO:0010604	0.736	positive regulation of macromolecule metabolic process
GO:0051173	0.729	positive regulation of nitrogen compound metabolic process
GO:0048869	0.699	cellular developmental process
GO:0031325	0.691	positive regulation of cellular metabolic process
GO:0030154	0.627	cell differentiation
GO:0050896	0.610	response to stimulus
GO:0048856	0.594	anatomical structure development
GO:0000122	0.446	negative regulation of transcription by RNA polymerase II
GO:0051246	0.355	regulation of protein metabolic process
GO:0048468	0.316	cell development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.442	protein-containing complex
GO:0005737	0.384	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]