StarFunc result for job id O75084

User Input

>input (574 residues)
MRDPGAAAPLSSLGLCALVLALLGALSAGAGAQPYHGEKGISVPDHGFCQPISIPLCTDI
AYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPC
RSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYP
TAPYLPDLPFTALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRAN
GLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVA
VAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLT
WFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDA
LRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTV
PATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIV
GITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75084	1.000	1.000	9.748E-86	574	1.000	1.000	O75084.pdb.gz	FZD7_HUMAN Frizzled-7 OS=Homo sapiens OX=9606 GN=FZD7 PE=1 SV=2
2	AFDB:Q9PUK8	0.746	0.777	1.833E-73	549	0.843	0.882	Q9PUK8.pdb.gz	FZD7A_XENLA Frizzled-7-A OS=Xenopus laevis OX=8355 GN=fzd7-a PE=1 SV=2
3	AFDB:Q6NV44	0.770	0.790	8.466E-70	559	0.803	0.825	Q6NV44.pdb.gz	Q6NV44_DANRE Frizzled class receptor 7a OS=Danio rerio OX=7955 GN=fzd7a PE=2 SV=2
4	AFDB:Q9UP38	0.775	0.693	1.916E-69	647	0.780	0.692	Q9UP38.pdb.gz	FZD1_HUMAN Frizzled-1 OS=Homo sapiens OX=9606 GN=FZD1 PE=1 SV=2
5	AFDB:A7YYJ5	0.674	0.694	2.297E-69	557	0.775	0.799	A7YYJ5.pdb.gz
6	AFDB:Q08464	0.677	0.681	2.027E-68	570	0.761	0.767	Q08464.pdb.gz	FZD2_RAT Frizzled-2 OS=Rattus norvegicus OX=10116 GN=Fzd2 PE=1 SV=1
7	AFDB:F1QBI2	0.689	0.716	3.778E-65	550	0.700	0.731	F1QBI2.pdb.gz
8	AFDB:P18537	0.612	0.605	3.136E-49	581	0.465	0.460	P18537.pdb.gz	FRIZ_DROME Frizzled OS=Drosophila melanogaster OX=7227 GN=fz PE=1 SV=1
9	AFDB:O93274	0.591	0.584	1.369E-46	581	0.488	0.482	O93274.pdb.gz	FZD8_XENLA Frizzled-8 OS=Xenopus laevis OX=8355 GN=fzd8 PE=1 SV=1
10	AFDB:B3DIG4	0.567	0.550	4.876E-46	592	0.483	0.468	B3DIG4.pdb.gz	B3DIG4_DANRE Frizzled class receptor 5 OS=Danio rerio OX=7955 GN=fzd8c PE=2 SV=1
11	PDB:7evwR	0.557	0.922	2.281E-37	340	0.591	0.997	7evwR.pdb.gz
12	PDB:7e32R	0.313	0.583	1.626E-6	285	0.075	0.151	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
13	PDB:6wwzR	0.373	0.622	7.602E-6	310	0.071	0.132	6wwzR.pdb.gz
14	PDB:3aymA	0.309	0.471	1.971E-5	350	0.059	0.097	3aymA.pdb.gz	Crystallographic Analysis of the Primary Photochemical Reaction of Squid Rhodopsin
15	PDB:7w2zR	0.331	0.557	2.473E-5	301	0.077	0.146	7w2zR.pdb.gz	Molecular mechanism of agonism and inverse agonism in ghrelin receptor.
16	PDB:5w0pC	0.319	0.227	3.892E-5	850	0.059	0.040	5w0pC.pdb.gz
17	PDB:7f61A	0.325	0.558	7.346E-5	301	0.080	0.153	7f61A.pdb.gz	Structural basis for recognition of antihistamine drug by human histamine receptor.
18	PDB:7jvrR	0.333	0.653	9.644E-5	269	0.063	0.134	7jvrR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
19	PDB:7sqoR	0.321	0.608	9.644E-5	270	0.051	0.107	7sqoR.pdb.gz	Molecular mechanism of the wake-promoting agent TAK-925.
20	PDB:7vl9R	0.332	0.568	1.009E-4	302	0.078	0.149	7vl9R.pdb.gz	Identification and mechanism of G protein-biased ligands for chemokine receptor CCR1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B3DIG4	0.0	525	592	0.458	0.444	B3DIG4_DANRE Frizzled class receptor 5 OS=Danio rerio OX=7955 GN=fzd8c PE=2 SV=1
2	O70421	0.0	896	642	0.756	0.676	FZD1_MOUSE Frizzled-1 OS=Mus musculus OX=10090 GN=Fzd1 PE=1 SV=3
3	O75084	0.0	1182	574	1.000	1.000	FZD7_HUMAN Frizzled-7 OS=Homo sapiens OX=9606 GN=FZD7 PE=1 SV=2
4	P58421	0.0	523	559	0.462	0.474	FZD5_XENLA Frizzled-5 OS=Xenopus laevis OX=8355 GN=fzd5 PE=2 SV=1
5	Q08463	0.0	887	641	0.756	0.677	FZD1_RAT Frizzled-1 OS=Rattus norvegicus OX=10116 GN=Fzd1 PE=1 SV=1
6	Q08464	0.0	879	570	0.742	0.747	FZD2_RAT Frizzled-2 OS=Rattus norvegicus OX=10116 GN=Fzd2 PE=1 SV=1
7	Q14332	0.0	900	565	0.760	0.772	FZD2_HUMAN Frizzled-2 OS=Homo sapiens OX=9606 GN=FZD2 PE=1 SV=1
8	Q61090	0.0	1083	572	0.965	0.969	FZD7_MOUSE Frizzled-7 OS=Mus musculus OX=10090 GN=Fzd7 PE=1 SV=2
9	Q6NV44	0.0	957	559	0.796	0.818	Q6NV44_DANRE Frizzled class receptor 7a OS=Danio rerio OX=7955 GN=fzd7a PE=2 SV=2
10	Q8AVJ9	0.0	976	548	0.828	0.867	FZD7B_XENLA Frizzled-7-B OS=Xenopus laevis OX=8355 GN=fzd7-b PE=1 SV=1
11	Q8QFM3	0.0	925	557	0.786	0.810	Q8QFM3_DANRE Frizzled 7a OS=Danio rerio OX=7955 GN=fz7b PE=1 SV=1
12	Q90YL7	0.0	840	550	0.704	0.735	Q90YL7_DANRE Frizzled homolog 2 OS=Danio rerio OX=7955 GN=zfz2 PE=2 SV=1
13	Q90ZT3	0.0	952	559	0.793	0.814	Q90ZT3_DANRE Frizzled 7b OS=Danio rerio OX=7955 GN=zg07 PE=2 SV=1
14	Q9EQD0	0.0	525	585	0.477	0.468	FZD5_MOUSE Frizzled-5 OS=Mus musculus OX=10090 GN=Fzd5 PE=1 SV=3
15	Q9JIP6	0.0	900	570	0.756	0.761	FZD2_MOUSE Frizzled-2 OS=Mus musculus OX=10090 GN=Fzd2 PE=2 SV=1
16	Q9PUK8	0.0	990	549	0.836	0.874	FZD7A_XENLA Frizzled-7-A OS=Xenopus laevis OX=8355 GN=fzd7-a PE=1 SV=2
17	Q9UP38	0.0	909	647	0.770	0.683	FZD1_HUMAN Frizzled-1 OS=Homo sapiens OX=9606 GN=FZD1 PE=1 SV=2
18	Q9YI00	0.0	533	579	0.470	0.466	Q9YI00_DANRE Frizzled 8a protein OS=Danio rerio OX=7955 GN=zg05 PE=2 SV=1
19	Q24760	2.24e-180	523	580	0.467	0.462	FRIZ_DROVI Frizzled OS=Drosophila virilis OX=7244 GN=fz PE=2 SV=3
20	Q8CHL0	4.46e-180	522	585	0.477	0.468	FZD5_RAT Frizzled-5 OS=Rattus norvegicus OX=10116 GN=Fzd5 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05462 Dicty_CAR	3.8	18.1	Slime mold cyclic AMP receptor
2	PF01534 Frizzled	2.6e-139	475.5	Frizzled/Smoothened family membrane region
3	PF01392 Fz	1.9e-29	114.0	Fz domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000286201

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361818	0.998	Syndecan-4
2	9606.ENSP00000264634	0.997	Protein Wnt-5a
3	9606.ENSP00000285018	0.995	Protein Wnt-7a
4	9606.ENSP00000368169	0.995	Segment polarity protein dishevelled homolog DVL-1
5	9606.ENSP00000225512	0.993	Proto-oncogene Wnt-3
6	9606.ENSP00000316054	0.984	Segment polarity protein dishevelled homolog DVL-3
7	9606.ENSP00000005340	0.980	Segment polarity protein dishevelled homolog DVL-2
8	9606.ENSP00000261349	0.978	Low-density lipoprotein receptor-related protein 6
9	9606.ENSP00000364860	0.962	Tyrosine-protein kinase transmembrane receptor ROR2
10	9606.ENSP00000325526	0.958	Protein Wnt-11
11	9606.ENSP00000284523	0.952	Protein Wnt-3a
12	9606.ENSP00000219255	0.946	Partitioning defective 6 homolog alpha
13	9606.ENSP00000293549	0.944	Proto-oncogene Wnt-1
14	9606.ENSP00000294304	0.944	Low-density lipoprotein receptor-related protein 5
15	9606.ENSP00000358698	0.933	Protein Wnt-2b
16	9606.ENSP00000418754	0.926	Inactive tyrosine-protein kinase 7
17	9606.ENSP00000378974	0.923	Mitogen-activated protein kinase 8
18	9606.ENSP00000380379	0.907	Protein Wnt-5b
19	9606.ENSP00000351605	0.906	Frizzled-6
20	9606.ENSP00000437489	0.906	Frizzled-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017147	1.000	Wnt-protein binding
GO:0042813	1.000	Wnt receptor activity
GO:0005102	0.734	signaling receptor binding
GO:0008289	0.455	lipid binding
GO:0001664	0.333	G protein-coupled receptor binding
GO:0005109	0.313	frizzled binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0023052	0.997	signaling
GO:0007154	0.997	cell communication
GO:0050896	0.995	response to stimulus
GO:0007165	0.989	signal transduction
GO:0007267	0.986	cell-cell signaling
GO:0032501	0.980	multicellular organismal process
GO:0198738	0.979	cell-cell signaling by wnt
GO:0048856	0.971	anatomical structure development
GO:0016055	0.967	Wnt signaling pathway
GO:0048518	0.880	positive regulation of biological process
GO:0019222	0.864	regulation of metabolic process
GO:0048522	0.850	positive regulation of cellular process
GO:0060255	0.825	regulation of macromolecule metabolic process
GO:0007275	0.784	multicellular organism development
GO:0031323	0.750	regulation of cellular metabolic process
GO:0051171	0.743	regulation of nitrogen compound metabolic process
GO:0080090	0.737	regulation of primary metabolic process
GO:0048519	0.706	negative regulation of biological process
GO:0048523	0.697	negative regulation of cellular process
GO:0010468	0.689	regulation of gene expression
GO:0048731	0.652	system development
GO:0048583	0.613	regulation of response to stimulus
GO:0009888	0.605	tissue development
GO:0048513	0.596	animal organ development
GO:0010604	0.591	positive regulation of macromolecule metabolic process
GO:0009653	0.553	anatomical structure morphogenesis
GO:0023051	0.549	regulation of signaling
GO:0060070	0.517	canonical Wnt signaling pathway
GO:0010646	0.504	regulation of cell communication
GO:0009889	0.481	regulation of biosynthetic process
GO:0010556	0.473	regulation of macromolecule biosynthetic process
GO:0031326	0.473	regulation of cellular biosynthetic process
GO:0051252	0.470	regulation of RNA metabolic process
GO:0009966	0.469	regulation of signal transduction
GO:0051173	0.467	positive regulation of nitrogen compound metabolic process
GO:0006355	0.460	regulation of DNA-templated transcription
GO:0031325	0.443	positive regulation of cellular metabolic process
GO:0050793	0.414	regulation of developmental process
GO:0048584	0.385	positive regulation of response to stimulus
GO:0030154	0.367	cell differentiation
GO:0035567	0.356	non-canonical Wnt signaling pathway
GO:0071840	0.340	cellular component organization or biogenesis
GO:0030111	0.336	regulation of Wnt signaling pathway
GO:0065009	0.326	regulation of molecular function
GO:0060828	0.325	regulation of canonical Wnt signaling pathway
GO:0045893	0.315	positive regulation of DNA-templated transcription
GO:0060429	0.313	epithelium development
GO:0016043	0.311	cellular component organization
GO:0009967	0.309	positive regulation of signal transduction
GO:0051239	0.306	regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.880	intracellular anatomical structure
GO:0005737	0.859	cytoplasm
GO:0043231	0.706	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]