StarFunc result for job id O75093

User Input

>input (1534 residues)
MALTPGWGSSAGPVRPELWLLLWAAAWRLGASACPALCTCTGTTVDCHGTGLQAIPKNIP
RNTERLELNGNNITRIHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQ
LHMLPELLFQNNQALSRLDLSENAIQAIPRKAFRGATDLKNLQLDKNQISCIEEGAFRAL
RGLEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIGLFT
QCSGPASLRGLNVAEVQKSEFSCSGQGEAGRVPTCTLSSGSCPAMCTCSNGIVDCRGKGL
TAIPANLPETMTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLN
SLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQSL
AKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPIETSGARCASPRRLANKRIGQI
KSKKFRCSAKEQYFIPGTEDYQLNSECNSDVVCPHKCRCEANVVECSSLKLTKIPERIPQ
STAELRLNNNEISILEATGMFKKLTHLKKINLSNNKVSEIEDGAFEGAASVSELHLTANQ
LESIRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNQITTVSPGAFDTL
QSLSTLNLLANPFNCNCQLAWLGGWLRKRKIVTGNPRCQNPDFLRQIPLQDVAFPDFRCE
EGQEEGGCLPRPQCPQECACLDTVVRCSNKHLRALPKGIPKNVTELYLDGNQFTLVPGQL
STFKYLQLVDLSNNKISSLSNSSFTNMSQLTTLILSYNALQCIPPLAFQGLRSLRLLSLH
GNDISTLQEGIFADVTSLSHLAIGANPLYCDCHLRWLSSWVKTGYKEPGIARCAGPQDME
GKLLLTTPAKKFECQGPPTLAVQAKCDLCLSSPCQNQGTCHNDPLEVYRCACPSGYKGRD
CEVSLDSCSSGPCENGGTCHAQEGEDAPFTCSCPTGFEGPTCGVNTDDCVDHACANGGVC
VDGVGNYTCQCPLQYEGKACEQLVDLCSPDLNPCQHEAQCVGTPDGPRCECMPGYAGDNC
SENQDDCRDHRCQNGAQCMDEVNSYSCLCAEGYSGQLCEIPPHLPAPKSPCEGTECQNGA
NCVDQGNRPVCQCLPGFGGPECEKLLSVNFVDRDTYLQFTDLQNWPRANITLQVSTAEDN
GILLYNGDNDHIAVELYQGHVRVSYDPGSYPSSAIYSAETINDGQFHTVELVAFDQMVNL
SIDGGSPMTMDNFGKHYTLNSEAPLYVGGMPVDVNSAAFRLWQILNGTGFHGCIRNLYIN
NELQDFTKTQMKPGVVPGCEPCRKLYCLHGICQPNATPGPMCHCEAGWVGLHCDQPADGP
CHGHKCVHGQCVPLDALSYSCQCQDGYSGALCNQAGALAEPCRGLQCLHGHCQASGTKGA
HCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVECRGSCPGQGCCQG
LRLKRRKFTFECSDGTSFAEEVEKPTKCGCALCA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8QDY6	0.633	0.634	0.000	1532	0.666	0.667	A0A2R8QDY6.pdb.gz
2	AFDB:A0A2R8RXU4	0.309	0.312	0.000	1521	0.626	0.631	A0A2R8RXU4.pdb.gz
3	AFDB:B8A498	0.674	0.678	0.000	1524	0.737	0.742	B8A498.pdb.gz
4	AFDB:F1RCV3	0.376	0.380	0.000	1516	0.555	0.561	F1RCV3.pdb.gz	F1RCV3_DANRE Slit homolog 3 (Drosophila) OS=Danio rerio OX=7955 GN=zgc:111911 PE=1 SV=1
5	AFDB:G5EFX6	0.294	0.318	0.000	1410	0.357	0.389	G5EFX6.pdb.gz	SLIT1_CAEEL Slit homolog 1 protein OS=Caenorhabditis elegans OX=6239 GN=slt-1 PE=1 SV=1
6	AFDB:O75093	1.000	1.000	0.000	1534	1.000	1.000	O75093.pdb.gz	SLIT1_HUMAN Slit homolog 1 protein OS=Homo sapiens OX=9606 GN=SLIT1 PE=1 SV=4
7	AFDB:O75094	0.445	0.447	0.000	1523	0.594	0.598	O75094.pdb.gz	SLIT3_HUMAN Slit homolog 3 protein OS=Homo sapiens OX=9606 GN=SLIT3 PE=2 SV=3
8	AFDB:O94813	0.510	0.511	0.000	1529	0.653	0.655	O94813.pdb.gz	SLIT2_HUMAN Slit homolog 2 protein OS=Homo sapiens OX=9606 GN=SLIT2 PE=1 SV=1
9	AFDB:P24014	0.231	0.234	0.000	1504	0.426	0.435	P24014.pdb.gz	SLIT_DROME Protein slit OS=Drosophila melanogaster OX=7227 GN=sli PE=1 SV=2
10	AFDB:Q90XG4	0.184	0.244	0.000	1095	0.400	0.560	Q90XG4.pdb.gz	Q90XG4_CHICK Slit-3 (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
11	PDB:3t6qA	0.107	0.242	2.109E-19	601	0.095	0.241	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
12	PDB:7tvfD	0.104	0.299	4.035E-18	515	0.077	0.229	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
13	PDB:7wv3A	0.091	0.198	4.431E-18	668	0.105	0.241	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
14	PDB:3b2dA	0.105	0.254	2.886E-17	601	0.098	0.250	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
15	PDB:7wrqA	0.109	0.256	5.826E-17	566	0.106	0.286	7wrqA.pdb.gz
16	PDB:6gffI	0.104	0.262	2.267E-16	551	0.100	0.278	6gffI.pdb.gz
17	PDB:3j0aA	0.108	0.199	5.701E-14	797	0.081	0.156	3j0aA.pdb.gz	Toll-like receptor 5 forms asymmetric dimers in the absence of flagellin.
18	PDB:2ft3F	0.095	0.440	7.551E-14	305	0.059	0.295	2ft3F.pdb.gz
19	PDB:1xcdA	0.106	0.511	1.755E-13	305	0.061	0.305	1xcdA.pdb.gz
20	PDB:5y31B	0.111	0.321	1.717E-10	511	0.061	0.182	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IU60	2085	1531	0.669	0.670	A0A0R4IU60_DANRE Slit homolog 1b (Drosophila) OS=Danio rerio OX=7955 GN=slit1b PE=4 SV=1
2	D2XV92	2553	1513	0.827	0.838	D2XV92_CHICK SLIT1 (Fragment) OS=Gallus gallus OX=9031 GN=SLIT1 PE=2 SV=1
3	F1RCV3	1731	1516	0.554	0.561	F1RCV3_DANRE Slit homolog 3 (Drosophila) OS=Danio rerio OX=7955 GN=zgc:111911 PE=1 SV=1
4	G5EFX6	948	1410	0.362	0.394	SLIT1_CAEEL Slit homolog 1 protein OS=Caenorhabditis elegans OX=6239 GN=slt-1 PE=1 SV=1
5	O75093	3153	1534	1.000	1.000	SLIT1_HUMAN Slit homolog 1 protein OS=Homo sapiens OX=9606 GN=SLIT1 PE=1 SV=4
6	O75094	1871	1523	0.589	0.593	SLIT3_HUMAN Slit homolog 3 protein OS=Homo sapiens OX=9606 GN=SLIT3 PE=2 SV=3
7	O88279	2932	1531	0.943	0.945	SLIT1_RAT Slit homolog 1 protein OS=Rattus norvegicus OX=10116 GN=Slit1 PE=1 SV=1
8	O88280	1876	1523	0.589	0.594	SLIT3_RAT Slit homolog 3 protein OS=Rattus norvegicus OX=10116 GN=Slit3 PE=2 SV=1
9	O94813	2094	1529	0.653	0.655	SLIT2_HUMAN Slit homolog 2 protein OS=Homo sapiens OX=9606 GN=SLIT2 PE=1 SV=1
10	P24014	1242	1504	0.426	0.435	SLIT_DROME Protein slit OS=Drosophila melanogaster OX=7227 GN=sli PE=1 SV=2
11	Q3S2J2	2316	1524	0.733	0.738	Q3S2J2_DANRE Slit homolog 1 protein precursor OS=Danio rerio OX=7955 GN=slit1a PE=1 SV=1
12	Q3Y6S4	2079	1532	0.668	0.669	Q3Y6S4_DANRE Slit homolog 1b precursor OS=Danio rerio OX=7955 GN=slit1b PE=2 SV=1
13	Q80TR4	2927	1531	0.944	0.946	SLIT1_MOUSE Slit homolog 1 protein OS=Mus musculus OX=10090 GN=Slit1 PE=1 SV=2
14	Q90XG2	1083	783	0.328	0.642	Q90XG2_CHICK Slit-2 (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
15	Q90XG4	1304	1095	0.402	0.563	Q90XG4_CHICK Slit-3 (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
16	Q90Z43	882	792	0.270	0.523	Q90Z43_CHICK Slit3 protein (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
17	Q90Z44	1243	950	0.374	0.604	Q90Z44_CHICK Slit2 protein (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
18	Q90Z45	1278	738	0.406	0.844	Q90Z45_CHICK Slit1 protein (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
19	Q9DE36	1990	1512	0.627	0.636	Q9DE36_DANRE Slit homolog 2 protein precursor OS=Danio rerio OX=7955 GN=slit2 PE=1 SV=1
20	Q9R1B9	2060	1521	0.649	0.654	SLIT2_MOUSE Slit homolog 2 protein OS=Mus musculus OX=10090 GN=Slit2 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00008 EGF	2.3e-29	112.6	EGF-like domain
2	PF07974 EGF_2	9.8	18.0	EGF-like domain
3	PF12947 EGF_3	10	17.7	EGF domain
4	PF12661 hEGF	2.8e-14	64.3	Human growth factor-like EGF
5	PF00054 Laminin_G_1	6.8e-23	92.8	Laminin G domain
6	PF02210 Laminin_G_2	1e-23	95.7	Laminin G domain
7	PF13385 Laminin_G_3	5.2e+02	12.1	Concanavalin A-like lectin/glucanases superfamily
8	PF01463 LRRCT	1.2e-13	61.4	Leucine rich repeat C-terminal domain
9	PF16920 LRRCT_2	98	14.4	Leucine rich repeat C-terminal motif
10	PF01462 LRRNT	2.2e-24	95.8	Leucine rich repeat N-terminal domain
11	PF00560 LRR_1	0.38	22.2	Leucine Rich Repeat
12	PF12799 LRR_4	1.2e-37	138.3	Leucine Rich repeats (2 copies)
13	PF13306 LRR_5	5.4e-42	154.2	BspA type Leucine rich repeat region (6 copies)
14	PF13855 LRR_8	4.1e-103	348.5	Leucine rich repeat
15	PF14580 LRR_9	7.3e-15	66.5	Leucine-rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000266058

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000417335	0.997	Roundabout homolog 2
2	9606.ENSP00000420321	0.997	Roundabout homolog 1
3	9606.ENSP00000269141	0.963	Cadherin-2
4	9606.ENSP00000380903	0.947	Roundabout homolog 3
5	9606.ENSP00000361423	0.938	Tyrosine-protein kinase ABL1
6	9606.ENSP00000344456	0.930	Catenin beta-1
7	9606.ENSP00000256925	0.912	CDK5 and ABL1 enzyme substrate 1
8	9606.ENSP00000382004	0.909	Catenin delta-1
9	9606.ENSP00000304669	0.903	Catenin alpha-1
10	9606.ENSP00000389140	0.863	Netrin receptor DCC
11	9606.ENSP00000173229	0.846	Netrin-1
12	9606.ENSP00000304945	0.838	Roundabout homolog 4
13	9606.ENSP00000265362	0.794	Semaphorin-3A
14	9606.ENSP00000347198	0.744	SLIT-ROBO Rho GTPase-activating protein 1
15	9606.ENSP00000233154	0.709	Cytoplasmic protein NCK2
16	9606.ENSP00000331902	0.697	Collagen alpha-5(IV) chain
17	9606.ENSP00000332737	0.684	Netrin receptor UNC5A
18	9606.ENSP00000374323	0.684	Ephrin type-A receptor 6
19	9606.ENSP00000298943	0.675	Complement C1q-like protein 3
20	9606.ENSP00000381499	0.668	Paired box protein Pax-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0048495	0.834	Roundabout binding
GO:0097367	0.649	carbohydrate derivative binding
GO:1901681	0.493	sulfur compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0007399	0.987	nervous system development
GO:0050789	0.983	regulation of biological process
GO:0009653	0.980	anatomical structure morphogenesis
GO:0050794	0.973	regulation of cellular process
GO:0050896	0.963	response to stimulus
GO:0006935	0.943	chemotaxis
GO:0032990	0.935	cell part morphogenesis
GO:0022008	0.926	neurogenesis
GO:0048812	0.922	neuron projection morphogenesis
GO:0061564	0.905	axon development
GO:0050919	0.904	negative chemotaxis
GO:0048513	0.903	animal organ development
GO:0060322	0.752	head development
GO:0048667	0.728	cell morphogenesis involved in neuron differentiation
GO:0007417	0.698	central nervous system development
GO:0007409	0.696	axonogenesis
GO:0048519	0.652	negative regulation of biological process
GO:0097485	0.589	neuron projection guidance
GO:0007411	0.573	axon guidance
GO:0007420	0.549	brain development
GO:0051128	0.546	regulation of cellular component organization
GO:0048523	0.523	negative regulation of cellular process
GO:0050793	0.463	regulation of developmental process
GO:0048518	0.461	positive regulation of biological process
GO:0051716	0.460	cellular response to stimulus
GO:0048522	0.447	positive regulation of cellular process
GO:0048583	0.436	regulation of response to stimulus
GO:0007154	0.423	cell communication
GO:0045595	0.397	regulation of cell differentiation
GO:0023052	0.393	signaling
GO:0051239	0.383	regulation of multicellular organismal process
GO:0007165	0.306	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.998	cell periphery
GO:0016020	0.998	membrane
GO:0005576	0.996	extracellular region
GO:0005615	0.993	extracellular space
GO:0005886	0.991	plasma membrane
GO:0043231	0.722	intracellular membrane-bounded organelle
GO:0005737	0.642	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]