StarFunc result for job id O75094

User Input

>input (1523 residues)
MAPGWAGVGAAVRARLALALALASVLSGPPAVACPTKCTCSAASVDCHGLGLRAVPRGIP
RNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNK
LQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRAL
RDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTVGQFT
LCMAPVHLRGFNVADVQKKEYVCPAPHSEPPSCNANSISCPSPCTCSNNIVDCRGKGLME
IPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSL
VLYGNKITEIVKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISK
GLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKS
KKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLN
DNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRV
FRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINL
LSNPFNCNCHLAWLGKWLRKRRIVSGNPRCQKPFFLKEIPIQDVAIQDFTCDGNEESSCQ
LSPRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAVPRELSALRHLTLI
DLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPE
GSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPT
HRFQCKGPVDINIVAKCNACLSSPCKNNGTCTQDPVELYRCACPYSYKGKDCTVPINTCI
QNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVC
ICPPNYTGELCDEVIDHCVPELNLCQHEAKCIPLDKGFSCECVPGYSGKLCETDNDDCVA
HKCRHGAQCVDTINGYTCTCPQGFSGPFCEHPPPMVLLQTSPCDQYECQNGAQCIVVQQE
PTCRCPPGFAGPRCEKLITVNFVGKDSYVELASAKVRPQANISLQVATDKDNGILLYKGD
NDPLALELYQGHVRLVYDSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPK
SLGKLQKQPAVGINSPLYLGGIPTSTGLSALRQGTDRPLGGFHGCIHEVRINNELQDFKA
LPPQSLGVSPGCKSCTVCKHGLCRSVEKDSVVCECRPGWTGPLCDQEARDPCLGHRCHHG
KCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSG
EHCQQENPCLGQVVREVIRRQKGYASCATASKVPIMECRGGCGPQCCQPTRSKRRKYVFQ
CTDGSSFVEEVERHLECGCLACS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8QDY6	0.415	0.413	0.000	1532	0.573	0.570	A0A2R8QDY6.pdb.gz
2	AFDB:A0A2R8RXU4	0.308	0.308	0.000	1521	0.647	0.648	A0A2R8RXU4.pdb.gz
3	AFDB:B8A498	0.351	0.351	0.000	1524	0.585	0.585	B8A498.pdb.gz
4	AFDB:F1RCV3	0.264	0.265	0.000	1516	0.689	0.692	F1RCV3.pdb.gz	F1RCV3_DANRE Slit homolog 3 (Drosophila) OS=Danio rerio OX=7955 GN=zgc:111911 PE=1 SV=1
5	AFDB:G5EFX6	0.362	0.384	0.000	1410	0.349	0.377	G5EFX6.pdb.gz	SLIT1_CAEEL Slit homolog 1 protein OS=Caenorhabditis elegans OX=6239 GN=slt-1 PE=1 SV=1
6	AFDB:O75093	0.448	0.446	0.000	1534	0.597	0.593	O75093.pdb.gz	SLIT1_HUMAN Slit homolog 1 protein OS=Homo sapiens OX=9606 GN=SLIT1 PE=1 SV=4
7	AFDB:O75094	1.000	1.000	0.000	1523	1.000	1.000	O75094.pdb.gz	SLIT3_HUMAN Slit homolog 3 protein OS=Homo sapiens OX=9606 GN=SLIT3 PE=2 SV=3
8	AFDB:O94813	0.571	0.569	0.000	1529	0.664	0.662	O94813.pdb.gz	SLIT2_HUMAN Slit homolog 2 protein OS=Homo sapiens OX=9606 GN=SLIT2 PE=1 SV=1
9	AFDB:P24014	0.292	0.295	0.000	1504	0.420	0.426	P24014.pdb.gz	SLIT_DROME Protein slit OS=Drosophila melanogaster OX=7227 GN=sli PE=1 SV=2
10	AFDB:Q90XG4	0.216	0.285	0.000	1095	0.587	0.816	Q90XG4.pdb.gz	Q90XG4_CHICK Slit-3 (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
11	PDB:7wv3A	0.109	0.229	5.802E-18	668	0.102	0.234	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
12	PDB:3t6qA	0.117	0.273	7.336E-18	601	0.097	0.246	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
13	PDB:7wrqA	0.108	0.282	1.706E-17	566	0.110	0.297	7wrqA.pdb.gz
14	PDB:6gffI	0.106	0.267	3.449E-17	551	0.102	0.283	6gffI.pdb.gz
15	PDB:3b2dA	0.105	0.240	5.753E-16	601	0.088	0.223	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
16	PDB:7tvfD	0.098	0.278	2.041E-15	515	0.071	0.210	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
17	PDB:2ft3F	0.097	0.459	1.677E-13	305	0.060	0.302	2ft3F.pdb.gz
18	PDB:1xcdA	0.087	0.409	1.931E-13	305	0.060	0.298	1xcdA.pdb.gz
19	PDB:3j0aA	0.104	0.181	3.235E-13	797	0.081	0.156	3j0aA.pdb.gz	Toll-like receptor 5 forms asymmetric dimers in the absence of flagellin.
20	PDB:5yq5B	0.100	0.465	8.551E-10	306	0.055	0.275	5yq5B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IU60	1716	1531	0.573	0.570	A0A0R4IU60_DANRE Slit homolog 1b (Drosophila) OS=Danio rerio OX=7955 GN=slit1b PE=4 SV=1
2	D2XV92	1798	1513	0.582	0.586	D2XV92_CHICK SLIT1 (Fragment) OS=Gallus gallus OX=9031 GN=SLIT1 PE=2 SV=1
3	F1RCV3	2171	1516	0.687	0.691	F1RCV3_DANRE Slit homolog 3 (Drosophila) OS=Danio rerio OX=7955 GN=zgc:111911 PE=1 SV=1
4	G5EFX6	924	1410	0.362	0.391	SLIT1_CAEEL Slit homolog 1 protein OS=Caenorhabditis elegans OX=6239 GN=slt-1 PE=1 SV=1
5	O75093	1864	1534	0.599	0.595	SLIT1_HUMAN Slit homolog 1 protein OS=Homo sapiens OX=9606 GN=SLIT1 PE=1 SV=4
6	O75094	3127	1523	1.000	1.000	SLIT3_HUMAN Slit homolog 3 protein OS=Homo sapiens OX=9606 GN=SLIT3 PE=2 SV=3
7	O88279	1852	1531	0.592	0.589	SLIT1_RAT Slit homolog 1 protein OS=Rattus norvegicus OX=10116 GN=Slit1 PE=1 SV=1
8	O88280	2920	1523	0.939	0.939	SLIT3_RAT Slit homolog 3 protein OS=Rattus norvegicus OX=10116 GN=Slit3 PE=2 SV=1
9	O94813	2106	1529	0.666	0.664	SLIT2_HUMAN Slit homolog 2 protein OS=Homo sapiens OX=9606 GN=SLIT2 PE=1 SV=1
10	P24014	1218	1504	0.425	0.430	SLIT_DROME Protein slit OS=Drosophila melanogaster OX=7227 GN=sli PE=1 SV=2
11	Q3S2J2	1802	1524	0.581	0.581	Q3S2J2_DANRE Slit homolog 1 protein precursor OS=Danio rerio OX=7955 GN=slit1a PE=1 SV=1
12	Q3Y6S4	1708	1532	0.572	0.569	Q3Y6S4_DANRE Slit homolog 1b precursor OS=Danio rerio OX=7955 GN=slit1b PE=2 SV=1
13	Q80TR4	1840	1531	0.588	0.585	SLIT1_MOUSE Slit homolog 1 protein OS=Mus musculus OX=10090 GN=Slit1 PE=1 SV=2
14	Q90XG2	1132	783	0.341	0.663	Q90XG2_CHICK Slit-2 (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
15	Q90XG4	1907	1095	0.587	0.816	Q90XG4_CHICK Slit-3 (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
16	Q90Z43	1354	792	0.416	0.799	Q90Z43_CHICK Slit3 protein (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
17	Q90Z44	1281	950	0.388	0.622	Q90Z44_CHICK Slit2 protein (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
18	Q90Z45	889	738	0.280	0.579	Q90Z45_CHICK Slit1 protein (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
19	Q9DE36	2075	1512	0.649	0.653	Q9DE36_DANRE Slit homolog 2 protein precursor OS=Danio rerio OX=7955 GN=slit2 PE=1 SV=1
20	Q9R1B9	2086	1521	0.657	0.657	SLIT2_MOUSE Slit homolog 2 protein OS=Mus musculus OX=10090 GN=Slit2 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00008 EGF	1.7e-41	151.4	EGF-like domain
2	PF12947 EGF_3	1.7	20.2	EGF domain
3	PF12661 hEGF	1.2e-22	90.9	Human growth factor-like EGF
4	PF00054 Laminin_G_1	5e-16	70.5	Laminin G domain
5	PF02210 Laminin_G_2	1.6e-20	85.4	Laminin G domain
6	PF13385 Laminin_G_3	5.1e+02	12.1	Concanavalin A-like lectin/glucanases superfamily
7	PF01463 LRRCT	1.5e-08	45.6	Leucine rich repeat C-terminal domain
8	PF01462 LRRNT	7e-23	91.0	Leucine rich repeat N-terminal domain
9	PF00560 LRR_1	12	17.7	Leucine Rich Repeat
10	PF12799 LRR_4	1.9e-37	137.8	Leucine Rich repeats (2 copies)
11	PF13306 LRR_5	1.3e-39	146.5	BspA type Leucine rich repeat region (6 copies)
12	PF13855 LRR_8	5.9e-111	373.6	Leucine rich repeat
13	PF14580 LRR_9	9.2e-18	75.9	Leucine-rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000332164

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000420321	0.999	Roundabout homolog 1
2	9606.ENSP00000417335	0.998	Roundabout homolog 2
3	9606.ENSP00000304945	0.997	Roundabout homolog 4
4	9606.ENSP00000380903	0.979	Roundabout homolog 3
5	9606.ENSP00000173229	0.933	Netrin-1
6	9606.ENSP00000389140	0.874	Netrin receptor DCC
7	9606.ENSP00000264039	0.852	Glypican-1
8	9606.ENSP00000347198	0.739	SLIT-ROBO Rho GTPase-activating protein 1
9	9606.ENSP00000265362	0.721	Semaphorin-3A
10	9606.ENSP00000371936	0.708	Semaphorin-5A
11	9606.ENSP00000389588	0.693	Semaphorin-5B
12	9606.ENSP00000257414	0.685	Semaphorin-6A
13	9606.ENSP00000422591	0.675	Slit homolog 2 protein
14	9606.ENSP00000324857	0.667	Semaphorin-6D
15	9606.ENSP00000334329	0.661	Netrin receptor UNC5B
16	9606.ENSP00000255078	0.657	DNA-binding protein SMUBP-2
17	9606.ENSP00000341198	0.657	Neogenin
18	9606.ENSP00000266058	0.656	Slit homolog 1 protein
19	9606.ENSP00000357909	0.655	Semaphorin-6C
20	9606.ENSP00000377061	0.644	Plexin-A1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.999	signaling receptor binding
GO:0048495	0.794	Roundabout binding
GO:0098772	0.722	molecular function regulator activity
GO:0097367	0.697	carbohydrate derivative binding
GO:1901681	0.597	sulfur compound binding
GO:0008201	0.591	heparin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0007399	0.985	nervous system development
GO:0050896	0.983	response to stimulus
GO:0048523	0.955	negative regulation of cellular process
GO:0016043	0.881	cellular component organization
GO:0009653	0.877	anatomical structure morphogenesis
GO:0048869	0.875	cellular developmental process
GO:0030154	0.857	cell differentiation
GO:0048513	0.834	animal organ development
GO:0048468	0.798	cell development
GO:0007417	0.797	central nervous system development
GO:0040011	0.793	locomotion
GO:0051128	0.731	regulation of cellular component organization
GO:0030182	0.708	neuron differentiation
GO:0048666	0.647	neuron development
GO:0030030	0.636	cell projection organization
GO:0120036	0.634	plasma membrane bounded cell projection organization
GO:0120039	0.625	plasma membrane bounded cell projection morphogenesis
GO:0048812	0.624	neuron projection morphogenesis
GO:0007409	0.608	axonogenesis
GO:0042221	0.495	response to chemical
GO:0050793	0.447	regulation of developmental process
GO:0009605	0.445	response to external stimulus
GO:0048518	0.371	positive regulation of biological process
GO:0051239	0.369	regulation of multicellular organismal process
GO:0051716	0.363	cellular response to stimulus
GO:0048522	0.344	positive regulation of cellular process
GO:0048583	0.311	regulation of response to stimulus
GO:0019222	0.308	regulation of metabolic process
GO:0007154	0.302	cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005576	0.996	extracellular region
GO:0005886	0.993	plasma membrane
GO:0005615	0.992	extracellular space
GO:0043226	0.864	organelle
GO:0043231	0.789	intracellular membrane-bounded organelle
GO:0005737	0.634	cytoplasm
GO:0043230	0.413	extracellular organelle
GO:0065010	0.402	extracellular membrane-bounded organelle
GO:0031982	0.393	vesicle
GO:1903561	0.311	extracellular vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]