StarFunc result for job id O75095

User Input

>input (1541 residues)
MSFLEEARAAGRAVVLALVLLLLPAVPVGASVPPRPLLPLQPGMPHVCAEQELTLVGRRQ
PCVQALSHTVPVWKAGCGWQAWCVGHERRTVYYMGYRQVYTTEARTVLRCCRGWMQQPDE
EGCLSAECSASLCFHGGRCVPGSAQPCHCPPGFQGPRCQYDVDECRTHNGGCQHRCVNTP
GSYLCECKPGFRLHTDSRTCLAINSCALGNGGCQHHCVQLTITRHRCQCRPGFQLQEDGR
HCVRRSPCANRNGSCMHRCQVVRGLARCECHVGYQLAADGKACEDVDECAAGLAQCAHGC
LNTQGSFKCVCHAGYELGADGRQCYRIEMEIVNSCEANNGGCSHGCSHTSAGPLCTCPRG
YELDTDQRTCIDVDDCADSPCCQQVCTNNPGGYECGCYAGYRLSADGCGCEDVDECASSR
GGCEHHCTNLAGSFQCSCEAGYRLHEDRRGCSPLEEPMVDLDGELPFVRPLPHIAVLQDE
LPQLFQDDDVGADEEEAELRGEHTLTEKFVCLDDSFGHDCSLTCDDCRNGGTCLLGLDGC
DCPEGWTGLICNETCPPDTFGKNCSFSCSCQNGGTCDSVTGACRCPPGVSGTNCEDGCPK
GYYGKHCRKKCNCANRGRCHRLYGACLCDPGLYGRFCHLTCPPWAFGPGCSEECQCVQPH
TQSCDKRDGSCSCKAGFRGERCQAECELGYFGPGCWQACTCPVGVACDSVSGECGKRCPA
GFQGEDCGQECPVGTFGVNCSSSCSCGGAPCHGVTGQCRCPPGRTGEDCEADCPEGRWGL
GCQEICPACQHAARCDPETGACLCLPGFVGSRCQDVCPAGWYGPSCQTRCSCANDGHCHP
ATGHCSCAPGWTGFSCQRACDTGHWGPDCSHPCNCSAGHGSCDAISGLCLCEAGYVGPRC
EQQCPQGHFGPGCEQRCQCQHGAACDHVSGACTCPAGWRGTFCEHACPAGFFGLDCRSAC
NCTAGAACDAVNGSCLCPAGRRGPRCAETCPAHTYGHNCSQACACFNGASCDPVHGQCHC
APGWMGPSCLQACPAGLYGDNCRHSCLCQNGGTCDPVSGHCACPEGWAGLACEKECLPRD
VRAGCRHSGGCLNGGLCDPHTGRCLCPAGWTGDKCQSPCLRGWFGEACAQRCSCPPGAAC
HHVTGACRCPPGFTGSGCEQACPPGSFGEDCAQMCQCPGENPACHPATGTCSCAAGYHGP
SCQQRCPPGRYGPGCEQLCGCLNGGSCDAATGACRCPTGFLGTDCNLTCPQGRFGPNCTH
VCGCGQGAACDPVTGTCLCPPGRAGVRCERGCPQNRFGVGCEHTCSCRNGGLCHASNGSC
SCGLGWTGRHCELACPPGRYGAACHLECSCHNNSTCEPATGTCRCGPGFYGQACEHPCPP
GFHGAGCQGLCWCQHGAPCDPISGRCLCPAGFHGHFCERGCEPGSFGEGCHQRCDCDGGA
PCDPVTGLCLCPPGRSGATCNLDCRRGQFGPSCTLHCDCGGGADCDPVSGQCHCVDGYMG
PTCREGGPLRLPENPSLAQGSAGTLPASSRPTSRSGGPARH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75095	1.000	1.000	0.000	1541	1.000	1.000	O75095.pdb.gz	MEGF6_HUMAN Multiple epidermal growth factor-like domains protein 6 OS=Homo sapiens OX=9606 GN=MEGF6 PE=1 SV=4
2	AFDB:Q80V70	0.266	0.262	0.000	1572	0.777	0.762	Q80V70.pdb.gz	MEGF6_MOUSE Multiple epidermal growth factor-like domains protein 6 OS=Mus musculus OX=10090 GN=Megf6 PE=2 SV=3
3	AFDB:A6BM72	0.138	0.196	1.316E-81	1044	0.211	0.311	A6BM72.pdb.gz	MEG11_HUMAN Multiple epidermal growth factor-like domains protein 11 OS=Homo sapiens OX=9606 GN=MEGF11 PE=1 SV=3
4	AFDB:Q6DIB5	0.134	0.175	2.760E-80	1147	0.209	0.281	Q6DIB5.pdb.gz	MEG10_MOUSE Multiple epidermal growth factor-like domains protein 10 OS=Mus musculus OX=10090 GN=Megf10 PE=1 SV=1
5	AFDB:E9QJQ6	0.138	0.185	2.184E-77	1119	0.202	0.279	E9QJQ6.pdb.gz	MEG10_DANRE Multiple epidermal growth factor-like domains protein 10 OS=Danio rerio OX=7955 GN=megf10 PE=1 SV=1
6	AFDB:Q9W0A0	0.136	0.192	3.213E-71	1031	0.180	0.270	Q9W0A0.pdb.gz	DRPR_DROME Protein draper OS=Drosophila melanogaster OX=7227 GN=drpr PE=1 SV=3
7	AFDB:Q8VIK5	0.100	0.142	2.393E-67	1034	0.172	0.256	Q8VIK5.pdb.gz	PEAR1_MOUSE Platelet endothelial aggregation receptor 1 OS=Mus musculus OX=10090 GN=Pear1 PE=1 SV=1
8	AFDB:Q5VY43	0.103	0.145	4.726E-65	1037	0.175	0.259	Q5VY43.pdb.gz	PEAR1_HUMAN Platelet endothelial aggregation receptor 1 OS=Homo sapiens OX=9606 GN=PEAR1 PE=1 SV=1
9	AFDB:P59222	0.099	0.147	5.741E-31	833	0.099	0.182	P59222.pdb.gz	SREC2_MOUSE Scavenger receptor class F member 2 OS=Mus musculus OX=10090 GN=Scarf2 PE=1 SV=1
10	AFDB:O00339	0.057	0.085	3.570E-24	956	0.083	0.134	O00339.pdb.gz	MATN2_HUMAN Matrilin-2 OS=Homo sapiens OX=9606 GN=MATN2 PE=1 SV=4
11	PDB:7q3nU	0.050	0.193	1.681E-4	292	0.030	0.158	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
12	PDB:5es4B	0.044	0.077	2.427E-3	674	0.033	0.076	5es4B.pdb.gz	Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
13	PDB:4g1eB	0.047	0.076	3.924E-3	709	0.028	0.061	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
14	PDB:7nxdB	0.044	0.080	1.749E-2	690	0.026	0.058	7nxdB.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
15	PDB:4bxsA	0.027	0.164	4.336E-2	248	0.010	0.060	4bxsA.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
16	PDB:4bxwB	0.024	0.126	6.963E-1	287	0.009	0.049	4bxwB.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
17	PDB:7mn8B	0.028	0.050	8.621E-1	579	0.023	0.062	7mn8B.pdb.gz
18	PDB:6uzbA	0.027	0.055	1.636	562	0.003	0.009	6uzbA.pdb.gz	Atomic structures of anthrax toxin protective antigen channels bound to partially unfolded lethal and edema factors.
19	PDB:6pxvA	0.033	0.053	1.820	823	0.012	0.023	6pxvA.pdb.gz
20	PDB:1haqA	0.042	0.049	2.377	1213	0.041	0.052	1haqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75095	0.0	3002	1541	1.000	1.000	MEGF6_HUMAN Multiple epidermal growth factor-like domains protein 6 OS=Homo sapiens OX=9606 GN=MEGF6 PE=1 SV=4
2	Q80V70	0.0	2282	1572	0.777	0.762	MEGF6_MOUSE Multiple epidermal growth factor-like domains protein 6 OS=Mus musculus OX=10090 GN=Megf6 PE=2 SV=3
3	A6BM72	2.46e-157	507	1044	0.202	0.298	MEG11_HUMAN Multiple epidermal growth factor-like domains protein 11 OS=Homo sapiens OX=9606 GN=MEGF11 PE=1 SV=3
4	Q80T91	2.64e-157	508	1091	0.205	0.290	MEG11_MOUSE Multiple epidermal growth factor-like domains protein 11 OS=Mus musculus OX=10090 GN=Megf11 PE=1 SV=3
5	Q96KG7	4.76e-157	509	1140	0.201	0.272	MEG10_HUMAN Multiple epidermal growth factor-like domains protein 10 OS=Homo sapiens OX=9606 GN=MEGF10 PE=1 SV=1
6	Q6DIB5	4.70e-155	504	1147	0.199	0.268	MEG10_MOUSE Multiple epidermal growth factor-like domains protein 10 OS=Mus musculus OX=10090 GN=Megf10 PE=1 SV=1
7	E9QJQ6	4.93e-155	503	1119	0.199	0.274	MEG10_DANRE Multiple epidermal growth factor-like domains protein 10 OS=Danio rerio OX=7955 GN=megf10 PE=1 SV=1
8	Q9XWD6	1.07e-143	472	1111	0.198	0.275	CED1_CAEEL Cell death abnormality protein 1 OS=Caenorhabditis elegans OX=6239 GN=ced-1 PE=1 SV=1
9	Q9W0A0	3.64e-140	460	1031	0.189	0.282	DRPR_DROME Protein draper OS=Drosophila melanogaster OX=7227 GN=drpr PE=1 SV=3
10	Q8VIK5	4.73e-129	430	1034	0.177	0.263	PEAR1_MOUSE Platelet endothelial aggregation receptor 1 OS=Mus musculus OX=10090 GN=Pear1 PE=1 SV=1
11	Q5VY43	7.64e-126	421	1037	0.173	0.257	PEAR1_HUMAN Platelet endothelial aggregation receptor 1 OS=Homo sapiens OX=9606 GN=PEAR1 PE=1 SV=1
12	F1RCH4	1.03e-54	213	2475	0.271	0.168	F1RCH4_DANRE Neurogenic locus notch homolog protein 2 precursor OS=Danio rerio OX=7955 GN=notch6 PE=3 SV=1
13	P46530	1.59e-53	209	2437	0.273	0.172	NOTC1_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio OX=7955 GN=notch1a PE=2 SV=1
14	Q01705	6.12e-53	207	2531	0.277	0.169	NOTC1_MOUSE Neurogenic locus notch homolog protein 1 OS=Mus musculus OX=10090 GN=Notch1 PE=1 SV=3
15	P46531	1.40e-52	206	2555	0.277	0.167	NOTC1_HUMAN Neurogenic locus notch homolog protein 1 OS=Homo sapiens OX=9606 GN=NOTCH1 PE=1 SV=4
16	P21783	1.45e-52	206	2524	0.265	0.162	NOTC1_XENLA Neurogenic locus notch homolog protein 1 OS=Xenopus laevis OX=8355 GN=notch1 PE=1 SV=3
17	Q07008	2.13e-52	206	2531	0.276	0.168	NOTC1_RAT Neurogenic locus notch homolog protein 1 OS=Rattus norvegicus OX=10116 GN=Notch1 PE=1 SV=3
18	G3I6Z6	2.36e-52	206	2527	0.278	0.169	NOTC1_CRIGR Neurogenic locus notch homolog protein 1 OS=Cricetulus griseus OX=10029 GN=NOTCH1 PE=1 SV=2
19	Q9VS89	2.58e-52	205	1618	0.091	0.087	Q9VS89_DROME FI18763p1 OS=Drosophila melanogaster OX=7227 GN=frac PE=2 SV=4
20	F1R0I7	1.58e-51	201	995	0.080	0.124	F1R0I7_DANRE Scube3 OS=Danio rerio OX=7955 GN=scube3 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	5.7e-18	75.8	Complement Clr-like EGF-like
2	PF00008 EGF	0.4	22.3	EGF-like domain
3	PF07974 EGF_2	4	19.2	EGF-like domain
4	PF12947 EGF_3	8.8	17.9	EGF domain
5	PF07645 EGF_CA	9.1e-18	75.5	Calcium-binding EGF domain
6	PF14670 FXa_inhibition	1.8e-31	119.5	Coagulation Factor Xa inhibitory site
7	PF12661 hEGF	2.7e-08	45.3	Human growth factor-like EGF
8	PF00053 Laminin_EGF	8.7e-30	113.9	Laminin EGF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000348982

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000270708	0.813	WD repeat-containing protein WRAP73
2	9606.ENSP00000384527	0.744	Zinc finger and BTB domain-containing protein 40
3	9606.ENSP00000386289	0.725	PTB domain-containing engulfment adapter protein 1
4	9606.ENSP00000297788	0.605	Coiled-coil domain-containing protein 136
5	9606.ENSP00000346300	0.559	Crk-like protein
6	9606.ENSP00000294600	0.545	Coiled-coil domain containing 27
7	9606.ENSP00000335560	0.540	Rho guanine nucleotide exchange factor 25
8	9606.ENSP00000271332	0.533	Cadherin EGF LAG seven-pass G-type receptor 2
9	9606.ENSP00000296266	0.520	Intraflagellar transport protein 122 homolog
10	9606.ENSP00000400880	0.519	Ubiquitin carboxyl-terminal hydrolase 17-like protein 11
11	9606.ENSP00000423503	0.519	Ubiquitin carboxyl-terminal hydrolase 17-like protein 18
12	9606.ENSP00000352455	0.517	Microfibrillar-associated protein 5
13	9606.ENSP00000367792	0.512	MORN repeat containing 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.990	regulation of biological process
GO:0009987	0.985	cellular process
GO:0050794	0.981	regulation of cellular process
GO:0032502	0.942	developmental process
GO:0048856	0.897	anatomical structure development
GO:0048518	0.640	positive regulation of biological process
GO:0032501	0.509	multicellular organismal process
GO:0050896	0.499	response to stimulus
GO:0007275	0.461	multicellular organism development
GO:0048522	0.439	positive regulation of cellular process
GO:0016043	0.438	cellular component organization
GO:0048731	0.429	system development
GO:0048519	0.310	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	1.000	cell periphery
GO:0031012	0.967	extracellular matrix
GO:0062023	0.935	collagen-containing extracellular matrix
GO:0005622	0.879	intracellular anatomical structure
GO:0043226	0.833	organelle
GO:0016020	0.826	membrane
GO:0043227	0.788	membrane-bounded organelle
GO:0005737	0.786	cytoplasm
GO:0005886	0.767	plasma membrane
GO:0043231	0.761	intracellular membrane-bounded organelle
GO:0005576	0.540	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]