StarFunc result for job id O75096

User Input

>input (1905 residues)
MRRQWGALLLGALLCAHGLASSPECACGRSHFTCAVSALGECTCIPAQWQCDGDNDCGDH
SDEDGCILPTCSPLDFHCDNGKCIRRSWVCDGDNDCEDDSDEQDCPPRECEEDEFPCQNG
YCIRSLWHCDGDNDCGDNSDEQCDMRKCSDKEFRCSDGSCIAEHWYCDGDTDCKDGSDEE
NCPSAVPAPPCNLEEFQCAYGRCILDIYHCDGDDDCGDWSDESDCSSHQPCRSGEFMCDS
GLCINAGWRCDGDADCDDQSDERNCTTSMCTAEQFRCHSGRCVRLSWRCDGEDDCADNSD
EENCENTGSPQCALDQFLCWNGRCIGQRKLCNGVNDCGDNSDESPQQNCRPRTGEENCNV
NNGGCAQKCQMVRGAVQCTCHTGYRLTEDGHTCQDVNECAEEGYCSQGCTNSEGAFQCWC
ETGYELRPDRRSCKALGPEPVLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFHHRRE
LVFWSDVTLDRILRANLNGSNVEEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRIEVANL
DGAHRKVLLWQNLEKPRAIALHPMEGTIYWTDWGNTPRIEASSMDGSGRRIIADTHLFWP
NGLTIDYAGRRMYWVDAKHHVIERANLDGSHRKAVISQGLPHPFAITVFEDSLYWTDWHT
KSINSANKFTGKNQEIIRNKLHFPMDIHTLHPQRQPAGKNRCGDNNGGCTHLCLPSGQNY
TCACPTGFRKISSHACAQSLDKFLLFARRMDIRRISFDTEDLSDDVIPLADVRSAVALDW
DSRDDHVYWTDVSTDTISRAKWDGTGQEVVVDTSLESPAGLAIDWVTNKLYWTDAGTDRI
EVANTDGSMRTVLIWENLDRPRDIVVEPMGGYMYWTDWGASPKIERAGMDASGRQVIISS
NLTWPNGLAIDYGSQRLYWADAGMKTIEFAGLDGSKRKVLIGSQLPHPFGLTLYGERIYW
TDWQTKSIQSADRLTGLDRETLQENLENLMDIHVFHRRRPPVSTPCAMENGGCSHLCLRS
PNPSGFSCTCPTGINLLSDGKTCSPGMNSFLIFARRIDIRMVSLDIPYFADVVVPINITM
KNTIAIGVDPQEGKVYWSDSTLHRISRANLDGSQHEDIITTGLQTTDGLAVDAIGRKVYW
TDTGTNRIEVGNLDGSMRKVLVWQNLDSPRAIVLYHEMGFMYWTDWGENAKLERSGMDGS
DRAVLINNNLGWPNGLTVDKASSQLLWADAHTERIEAADLNGANRHTLVSPVQHPYGLTL
LDSYIYWTDWQTRSIHRADKGTGSNVILVRSNLPGLMDMQAVDRAQPLGFNKCGSRNGGC
SHLCLPRPSGFSCACPTGIQLKGDGKTCDPSPETYLLFSSRGSIRRISLDTSDHTDVHVP
VPELNNVISLDYDSVDGKVYYTDVFLDVIRRADLNGSNMETVIGRGLKTTDGLAVDWVAR
NLYWTDTGRNTIEASRLDGSCRKVLINNSLDEPRAIAVFPRKGYLFWTDWGHIAKIERAN
LDGSERKVLINTDLGWPNGLTLDYDTRRIYWVDAHLDRIESADLNGKLRQVLVSHVSHPF
ALTQQDRWIYWTDWQTKSIQRVDKYSGRNKETVLANVEGLMDIIVVSPQRQTGTNACGVN
NGGCTHLCFARASDFVCACPDEPDSRPCSLVPGLVPPAPRATGMSEKSPVLPNTPPTTLY
SSTTRTRTSLEEVEGRCSERDARLGLCARSNDAVPAAPGEGLHISYAIGGLLSILLILVV
IAALMLYRHKKSKFTDPGMGNLTYSNPSYRTSTQEVKIEAIPKPAMYNQLCYKKEGGPDH
NYTKEKIKIVEGICLLSGDDAEWDDLKQLRSSRGGLLRDHVCMKTDTVSIQASSGSLDDT
ETEQLLQEEQSECSSVHTAATPERRGSLPDTGWKHERKLSSESQV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8PYI8	0.287	0.552	0.000	968	0.381	0.749	A0A2R8PYI8.pdb.gz	A0A2R8PYI8_DANRE Low density lipoprotein receptor-related protein 4 OS=Danio rerio OX=7955 GN=eni PE=4 SV=1
2	AFDB:O75096	1.000	1.000	0.000	1905	1.000	1.000	O75096.pdb.gz	LRP4_HUMAN Low-density lipoprotein receptor-related protein 4 OS=Homo sapiens OX=9606 GN=LRP4 PE=1 SV=4
3	AFDB:P98155	0.191	0.398	2.914E-72	873	0.162	0.354	P98155.pdb.gz	VLDLR_HUMAN Very low-density lipoprotein receptor OS=Homo sapiens OX=9606 GN=VLDLR PE=1 SV=1
4	AFDB:P98165	0.191	0.405	1.218E-71	863	0.162	0.357	P98165.pdb.gz	VLDLR_CHICK Very low-density lipoprotein receptor OS=Gallus gallus OX=9031 GN=VLDLR PE=1 SV=1
5	AFDB:P10493	0.158	0.238	2.330E-34	1245	0.114	0.174	P10493.pdb.gz	NID1_MOUSE Nidogen-1 OS=Mus musculus OX=10090 GN=Nid1 PE=1 SV=2
6	AFDB:P14543	0.157	0.236	2.452E-34	1247	0.097	0.148	P14543.pdb.gz	NID1_HUMAN Nidogen-1 OS=Homo sapiens OX=9606 GN=NID1 PE=1 SV=3
7	PDB:6jp6A	0.127	0.213	1.511E-19	998	0.064	0.122	6jp6A.pdb.gz
8	PDB:1n6dA	0.108	0.191	1.753E-18	1023	0.047	0.088	1n6dA.pdb.gz	Navigation Inside a Protease: Substrate Selection and Product Exit in the Tricorn Protease from Thermoplasma acidophilum
9	PDB:7mq8LR	0.106	0.240	1.352E-17	773	0.028	0.070	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
10	PDB:5hxbY	0.100	0.168	1.658E-17	1080	0.054	0.095	5hxbY.pdb.gz	A novel cereblon modulator recruits GSPT1 to the CRL4(CRBN) ubiquitin ligase.
11	PDB:1nr0A	0.085	0.234	3.060E-17	610	0.040	0.125	1nr0A.pdb.gz
12	PDB:7mq8LO	0.098	0.202	6.582E-17	848	0.036	0.080	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7mq8LT	0.108	0.216	6.582E-17	869	0.043	0.093	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7mqaLQ	0.085	0.188	1.154E-16	830	0.041	0.095	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	AFDB:O60336	0.091	0.108	2.147E-16	1514	0.067	0.084	O60336.pdb.gz	MABP1_HUMAN Mitogen-activated protein kinase-binding protein 1 OS=Homo sapiens OX=9606 GN=MAPKBP1 PE=1 SV=4
16	PDB:7ajuUL	0.126	0.265	2.894E-16	779	0.037	0.090	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
17	PDB:7mqaLO	0.099	0.213	3.932E-16	819	0.035	0.082	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	AFDB:A0A0R4IP15	0.048	0.056	4.291E-11	1428	0.088	0.117	A0A0R4IP15.pdb.gz	A0A0R4IP15_DANRE Neogenin 1a OS=Danio rerio OX=7955 GN=cb333 PE=1 SV=1
19	AFDB:P43146	0.052	0.058	3.309E-10	1447	0.092	0.122	P43146.pdb.gz	DCC_HUMAN Netrin receptor DCC OS=Homo sapiens OX=9606 GN=DCC PE=1 SV=2
20	AFDB:Q80U93	0.080	0.074	5.415E-6	2085	0.041	0.038	Q80U93.pdb.gz	NU214_MOUSE Nuclear pore complex protein Nup214 OS=Mus musculus OX=10090 GN=Nup214 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KFD1	760	4752	0.283	0.114	A0A0B4KFD1_DROME LDL receptor protein 1, isoform F OS=Drosophila melanogaster OX=7227 GN=LRP1 PE=1 SV=1
2	A0A0G2K0H3	1105	1613	0.292	0.345	A0A0G2K0H3_RAT Low-density lipoprotein receptor-related protein OS=Rattus norvegicus OX=10116 GN=Lrp6 PE=3 SV=1
3	A0A2R8PYI8	1207	968	0.336	0.662	A0A2R8PYI8_DANRE Low density lipoprotein receptor-related protein 4 OS=Danio rerio OX=7955 GN=eni PE=4 SV=1
4	A0A8I6AQY2	994	4469	0.317	0.135	A0A8I6AQY2_RAT LDL receptor related protein 1B OS=Rattus norvegicus OX=10116 GN=Lrp1b PE=3 SV=1
5	A0A8I6G721	1013	1560	0.279	0.341	A0A8I6G721_RAT Low-density lipoprotein receptor-related protein OS=Rattus norvegicus OX=10116 GN=Lrp5 PE=3 SV=1
6	A1Z7C4	761	4730	0.283	0.114	A1Z7C4_DROME LDL receptor protein 1, isoform G OS=Drosophila melanogaster OX=7227 GN=LRP1 PE=1 SV=2
7	A1Z9D7	840	1678	0.248	0.282	A1Z9D7_DROME Low-density lipoprotein receptor-related protein OS=Drosophila melanogaster OX=7227 GN=arr PE=2 SV=1
8	A2ARV4	668	4660	0.196	0.080	LRP2_MOUSE Low-density lipoprotein receptor-related protein 2 OS=Mus musculus OX=10090 GN=Lrp2 PE=1 SV=1
9	A8JTM7	886	4769	0.291	0.116	A8JTM7_DROME Megalin, isoform A OS=Drosophila melanogaster OX=7227 GN=mgl PE=1 SV=2
10	B2RYI1	1014	1600	0.279	0.333	B2RYI1_RAT Low-density lipoprotein receptor-related protein OS=Rattus norvegicus OX=10116 GN=Lrp5 PE=2 SV=1
11	B5L5I6	1077	1620	0.289	0.340	B5L5I6_DANRE Low-density lipoprotein receptor-related protein OS=Danio rerio OX=7955 GN=lrp6 PE=1 SV=1
12	C0HL13	1033	4652	0.321	0.131	LRP2_PIG Low-density lipoprotein receptor-related protein 2 OS=Sus scrofa OX=9823 GN=LRP2 PE=1 SV=1
13	D0EWS1	709	1430	0.207	0.276	D0EWS1_DANRE Low density lipoprotein-related protein 6 OS=Danio rerio OX=7955 GN=LRP6 PE=1 SV=1
14	E0AE56	1079	4673	0.336	0.137	E0AE56_DANRE Low-density lipoprotein receptor-related protein 2 OS=Danio rerio OX=7955 GN=lrp2 PE=1 SV=1
15	E1BGJ0	1061	4545	0.336	0.141	E1BGJ0_BOVIN LDL receptor related protein 1 OS=Bos taurus OX=9913 GN=LRP1 PE=1 SV=3
16	F1M443	994	4436	0.317	0.136	F1M443_RAT LDL receptor related protein 1B OS=Rattus norvegicus OX=10116 GN=Lrp1b PE=3 SV=4
17	F1MAD0	1015	1473	0.279	0.361	F1MAD0_RAT LDL receptor related protein 5 OS=Rattus norvegicus OX=10116 GN=Lrp5 PE=4 SV=3
18	F1QTJ4	1002	1615	0.283	0.334	F1QTJ4_DANRE Low density lipoprotein receptor-related protein 5 OS=Danio rerio OX=7955 GN=LRP6 PE=1 SV=1
19	F1QY34	1067	4549	0.334	0.140	F1QY34_DANRE Low density lipoprotein receptor-related protein 1Ab OS=Danio rerio OX=7955 GN=lrp1ab PE=1 SV=1
20	G3V928	1064	4545	0.337	0.141	LRP1_RAT Prolow-density lipoprotein receptor-related protein 1 OS=Rattus norvegicus OX=10116 GN=Lrp1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	5e-12	56.8	Complement Clr-like EGF-like
2	PF16472 DUF5050	6.1e-12	56.9	Domain of unknown function (DUF5050)
3	PF07645 EGF_CA	0.045	25.3	Calcium-binding EGF domain
4	PF14670 FXa_inhibition	2e-40	148.1	Coagulation Factor Xa inhibitory site
5	PF00057 Ldl_recept_a	1.8e-83	285.7	Low-density lipoprotein receptor domain class A
6	PF00058 Ldl_recept_b	6.1e-185	610.8	Low-density lipoprotein receptor repeat class B
7	PF06739 SBBP	4.3e+02	12.3	Beta-propeller repeat
8	PF08450 SGL	5.5e-23	93.4	SMP-30/Gluconolactonase/LRE-like region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367888

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363571	0.995	Muscle, skeletal receptor tyrosine-protein kinase
2	9606.ENSP00000368678	0.995	Agrin
3	9606.ENSP00000344432	0.814	Protein Dok-7
4	9606.ENSP00000301691	0.805	Sclerostin
5	9606.ENSP00000328251	0.765	Ribosomal oxygenase 2
6	9606.ENSP00000382428	0.759	Disks large homolog 4
7	9606.ENSP00000298854	0.706	43 kDa receptor-associated protein of the synapse
8	9606.ENSP00000410083	0.672	Vezatin
9	9606.ENSP00000285018	0.665	Protein Wnt-7a
10	9606.ENSP00000262027	0.661	Methionine--tRNA ligase, cytoplasmic
11	9606.ENSP00000473631	0.658	DnaJ homolog subfamily C member 3
12	9606.ENSP00000264377	0.657	Disintegrin and metalloproteinase domain-containing protein 23
13	9606.ENSP00000361066	0.640	Nuclear receptor coactivator 3
14	9606.ENSP00000385026	0.640	Neuronal acetylcholine receptor subunit alpha-2
15	9606.ENSP00000284981	0.636	Amyloid-beta A4 protein
16	9606.ENSP00000347684	0.607	LIM homeobox transcription factor 1-beta
17	9606.ENSP00000258385	0.586	Acetylcholine receptor subunit delta
18	9606.ENSP00000252486	0.562	Apolipoprotein E
19	9606.ENSP00000261758	0.529	LRP chaperone MESD
20	9606.ENSP00000265727	0.528	Disintegrin and metalloproteinase domain-containing protein 22

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.770	signaling receptor binding
GO:0019899	0.732	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0032501	0.995	multicellular organismal process
GO:0048856	0.993	anatomical structure development
GO:0050896	0.991	response to stimulus
GO:0050789	0.989	regulation of biological process
GO:0050794	0.980	regulation of cellular process
GO:0007275	0.958	multicellular organism development
GO:0007154	0.942	cell communication
GO:0034330	0.929	cell junction organization
GO:0050808	0.921	synapse organization
GO:0009653	0.920	anatomical structure morphogenesis
GO:0007399	0.916	nervous system development
GO:0023052	0.900	signaling
GO:0048513	0.833	animal organ development
GO:0051716	0.821	cellular response to stimulus
GO:0048518	0.790	positive regulation of biological process
GO:0048869	0.745	cellular developmental process
GO:0030154	0.743	cell differentiation
GO:0023051	0.736	regulation of signaling
GO:0010646	0.735	regulation of cell communication
GO:0048522	0.712	positive regulation of cellular process
GO:0048583	0.708	regulation of response to stimulus
GO:0030182	0.694	neuron differentiation
GO:0048519	0.690	negative regulation of biological process
GO:0048523	0.684	negative regulation of cellular process
GO:0048468	0.680	cell development
GO:0009966	0.663	regulation of signal transduction
GO:0019222	0.652	regulation of metabolic process
GO:0060255	0.623	regulation of macromolecule metabolic process
GO:0031175	0.602	neuron projection development
GO:0051171	0.572	regulation of nitrogen compound metabolic process
GO:0080090	0.570	regulation of primary metabolic process
GO:0009893	0.560	positive regulation of metabolic process
GO:0007165	0.553	signal transduction
GO:0007267	0.540	cell-cell signaling
GO:0051239	0.531	regulation of multicellular organismal process
GO:0010604	0.524	positive regulation of macromolecule metabolic process
GO:0050793	0.499	regulation of developmental process
GO:0030111	0.488	regulation of Wnt signaling pathway
GO:0031323	0.479	regulation of cellular metabolic process
GO:0023057	0.409	negative regulation of signaling
GO:0048585	0.404	negative regulation of response to stimulus
GO:0051173	0.401	positive regulation of nitrogen compound metabolic process
GO:0008152	0.400	metabolic process
GO:0010648	0.395	negative regulation of cell communication
GO:0031325	0.348	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0071944	0.999	cell periphery
GO:0043226	0.993	organelle
GO:0005886	0.992	plasma membrane
GO:0005622	0.987	intracellular anatomical structure
GO:0030054	0.986	cell junction
GO:0043229	0.967	intracellular organelle
GO:0009986	0.933	cell surface
GO:0043231	0.921	intracellular membrane-bounded organelle
GO:0005737	0.912	cytoplasm
GO:0045202	0.737	synapse
GO:0005576	0.563	extracellular region
GO:0012505	0.475	endomembrane system
GO:0098590	0.394	plasma membrane region
GO:0032991	0.312	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]