StarFunc result for job id O75116

User Input

>input (1388 residues)
MSRPPPTGKMPGAPETAPGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFP
ALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAM
KLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNL
MSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMD
ETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLV
GTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWH
WDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYRENL
LLSDSPSCRETDSIQSRKNEESQEIQKKLYTLEEHLSNEMQAKEELEQKCKSVNTRLEKT
AKELEEEITLRKSVESALRQLEREKALLQHKNAEYQRKADHEADKKRNLENDVNSLKDQL
EDLKKRNQNSQISTEKVNQLQRQLDETNALLRTESDTAARLRKTQAESSKQIQQLESNNR
DLQDKNCLLETAKLKLEKEFINLQSALESERRDRTHGSEIINDLQGRICGLEEDLKNGKI
LLAKVELEKRQLQERFTDLEKEKSNMEIDMTYQLKVIQQSLEQEEAEHKATKARLADKNK
IYESIEEAKSEAMKEMEKKLLEERTLKQKVENLLLEAEKRCSLLDCDLKQSQQKINELLK
QKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLMEMKMN
LEKQNAELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVRELKEECEEKTKLGKELQQK
KQELQDERDSLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELEIKEMMARHKQE
LTEKDATIASLEETNRTLTSDVANLANEKEELNNKLKDVQEQLSRLKDEEISAAAIKAQF
EKQLLTERTLKTQAVNKLAEIMNRKEPVKRGNDTDVRRKEKENRKLHMELKSEREKLTQQ
MIKYQKELNEMQAQIAEESQIRIELQMTLDSKDSDIEQLRSQLQALHIGLDSSSIGSGPG
DAEADDGFPESRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQDKEQSNPYMVL
DIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGESKKEQEFPVEPVGEKSNYICHKG
HEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYD
ISTAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSR
QLAPNKPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IHT4	0.298	0.297	0.000	1396	0.747	0.743	A0A0R4IHT4.pdb.gz
2	AFDB:M3TYT0	0.375	0.375	0.000	1388	0.976	0.976	M3TYT0.pdb.gz	ROCK2_PIG Rho-associated protein kinase 2 OS=Sus scrofa OX=9823 GN=ROCK2 PE=1 SV=1
3	AFDB:Q9VXE3	0.329	0.329	2.242E-95	1390	0.425	0.424	Q9VXE3.pdb.gz	Q9VXE3_DROME Rho-associated protein kinase OS=Drosophila melanogaster OX=7227 GN=Rok PE=1 SV=1
4	AFDB:P92199	0.290	0.342	9.940E-79	1173	0.308	0.364	P92199.pdb.gz	ROCK_CAEEL Rho-associated protein kinase let-502 OS=Caenorhabditis elegans OX=6239 GN=let-502 PE=1 SV=1
5	AFDB:O14578	0.282	0.194	2.240E-50	2027	0.253	0.173	O14578.pdb.gz	CTRO_HUMAN Citron Rho-interacting kinase OS=Homo sapiens OX=9606 GN=CIT PE=1 SV=2
6	AFDB:E9PSL7	0.291	0.198	3.207E-50	2055	0.258	0.174	E9PSL7.pdb.gz	CTRO_RAT Citron rho-interacting kinase OS=Rattus norvegicus OX=10116 GN=Cit PE=1 SV=1
7	AFDB:O54874	0.280	0.226	4.390E-48	1732	0.267	0.214	O54874.pdb.gz	MRCKA_RAT Serine/threonine-protein kinase MRCK alpha OS=Rattus norvegicus OX=10116 GN=Cdc42bpa PE=1 SV=1
8	AFDB:Q6DT37	0.279	0.250	3.410E-47	1551	0.234	0.210	Q6DT37.pdb.gz	MRCKG_HUMAN Serine/threonine-protein kinase MRCK gamma OS=Homo sapiens OX=9606 GN=CDC42BPG PE=1 SV=2
9	AFDB:Q7TT49	0.286	0.233	3.088E-46	1713	0.252	0.204	Q7TT49.pdb.gz	MRCKB_RAT Serine/threonine-protein kinase MRCK beta OS=Rattus norvegicus OX=10116 GN=Cdc42bpb PE=1 SV=1
10	AFDB:Q9W1B0	0.275	0.234	7.034E-45	1637	0.236	0.200	Q9W1B0.pdb.gz	GEK_DROME Serine/threonine-protein kinase Genghis Khan OS=Drosophila melanogaster OX=7227 GN=gek PE=1 SV=1
11	PDB:6byrA	0.214	0.716	8.702E-26	405	0.091	0.311	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
12	PDB:6pjxA	0.220	0.546	1.385E-24	543	0.078	0.199	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
13	PDB:5x3fB	0.191	0.719	6.121E-24	349	0.080	0.318	5x3fB.pdb.gz
14	PDB:3nynA	0.221	0.531	1.540E-23	554	0.070	0.175	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.
15	PDB:3c4wB	0.213	0.549	3.155E-23	519	0.083	0.222	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
16	PDB:4yhjA	0.213	0.565	9.740E-23	501	0.079	0.218	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.
17	PDB:3pvuA	0.207	0.457	1.079E-22	609	0.068	0.156	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
18	PDB:4mk0A	0.213	0.450	3.691E-22	631	0.070	0.154	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
19	PDB:3pfqA	0.216	0.553	6.162E-22	523	0.082	0.218	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
20	PDB:5dykA	0.193	0.327	6.162E-22	809	0.070	0.120	5dykA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IVY5	1775	1359	0.638	0.651	A0A0R4IVY5_DANRE Rho-associated protein kinase OS=Danio rerio OX=7955 GN=rock1 PE=1 SV=2
2	A0A2P9DU05	2863	1388	1.000	1.000	A0A2P9DU05_HUMAN Rho-associated protein kinase OS=Homo sapiens OX=9606 GN=ROCK2 PE=2 SV=1
3	A0A8C0NIR0	1755	1355	0.643	0.659	A0A8C0NIR0_CANLF Rho-associated protein kinase OS=Canis lupus familiaris OX=9615 GN=ROCK1 PE=1 SV=1
4	E9PF63	2339	1145	0.825	1.000	E9PF63_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=ROCK2 PE=1 SV=1
5	F1MF50	1774	1356	0.645	0.660	F1MF50_BOVIN Rho-associated protein kinase OS=Bos taurus OX=9913 GN=ROCK1 PE=3 SV=3
6	I3LFH3	1389	1134	0.524	0.642	I3LFH3_PIG non-specific serine/threonine protein kinase OS=Sus scrofa OX=9823 GN=ROCK1 PE=1 SV=4
7	M3TYT0	2797	1388	0.977	0.977	ROCK2_PIG Rho-associated protein kinase 2 OS=Sus scrofa OX=9823 GN=ROCK2 PE=1 SV=1
8	O75116	2863	1388	1.000	1.000	ROCK2_HUMAN Rho-associated protein kinase 2 OS=Homo sapiens OX=9606 GN=ROCK2 PE=1 SV=4
9	P70335	1760	1354	0.643	0.659	ROCK1_MOUSE Rho-associated protein kinase 1 OS=Mus musculus OX=10090 GN=Rock1 PE=1 SV=1
10	P70336	2771	1388	0.966	0.966	ROCK2_MOUSE Rho-associated protein kinase 2 OS=Mus musculus OX=10090 GN=Rock2 PE=1 SV=1
11	Q13464	1753	1354	0.644	0.660	ROCK1_HUMAN Rho-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=ROCK1 PE=1 SV=1
12	Q28021	2801	1388	0.978	0.978	ROCK2_BOVIN Rho-associated protein kinase 2 OS=Bos taurus OX=9913 GN=ROCK2 PE=1 SV=1
13	Q62868	2763	1388	0.964	0.964	ROCK2_RAT Rho-associated protein kinase 2 OS=Rattus norvegicus OX=10116 GN=Rock2 PE=1 SV=2
14	Q63644	1738	1369	0.641	0.650	ROCK1_RAT Rho-associated protein kinase 1 OS=Rattus norvegicus OX=10116 GN=Rock1 PE=1 SV=1
15	Q90Y37	2104	1375	0.751	0.758	Q90Y37_DANRE Rho-associated protein kinase OS=Danio rerio OX=7955 GN=rock2 PE=1 SV=1
16	Q961D4	1048	1390	0.442	0.441	Q961D4_DROME Rho-associated protein kinase OS=Drosophila melanogaster OX=7227 GN=Rok PE=2 SV=1
17	Q9U779	1049	1390	0.442	0.441	Q9U779_DROME Rho-associated protein kinase OS=Drosophila melanogaster OX=7227 GN=Rok PE=2 SV=1
18	Q9VXE3	1050	1390	0.442	0.441	Q9VXE3_DROME Rho-associated protein kinase OS=Drosophila melanogaster OX=7227 GN=Rok PE=1 SV=1
19	X2JC83	1051	1381	0.442	0.444	X2JC83_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Rok PE=1 SV=1
20	X2JE40	1044	1374	0.438	0.443	X2JE40_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Rok PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	68	14.8	Phosphotransferase enzyme family
2	PF00130 C1_1	0.34	22.2	Phorbol esters/diacylglycerol binding domain (C1 domain)
3	PF00169 PH	0.0012	30.7	PH domain
4	PF00069 Pkinase	1.5e-58	209.8	Protein kinase domain
5	PF07714 PK_Tyr_Ser-Thr	6.8e-26	102.7	Protein tyrosine and serine/threonine kinase
6	PF08912 Rho_Binding	2.8e-21	87.5	Rho Binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000317985

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400175	0.999	Transforming protein RhoA
2	9606.ENSP00000383118	0.989	Cell division control protein 42 homolog
3	9606.ENSP00000389168	0.989	Protein phosphatase 1 regulatory subunit 12A
4	9606.ENSP00000228841	0.978	Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
5	9606.ENSP00000279022	0.972	Myosin regulatory light polypeptide 9
6	9606.ENSP00000382697	0.969	Rho-associated protein kinase 1
7	9606.ENSP00000285735	0.963	Rho-related GTP-binding protein RhoC
8	9606.ENSP00000353408	0.961	Moesin
9	9606.ENSP00000463559	0.961	Myosin regulatory light chain 12B
10	9606.ENSP00000296930	0.959	Nucleophosmin
11	9606.ENSP00000398632	0.957	CD44 antigen
12	9606.ENSP00000361021	0.956	Phosphatase and tensin homolog
13	9606.ENSP00000356042	0.953	Ezrin
14	9606.ENSP00000384136	0.953	Radixin
15	9606.ENSP00000336740	0.951	LIM domain kinase 1
16	9606.ENSP00000476755	0.948	Protein phosphatase 1 regulatory subunit 12B
17	9606.ENSP00000339916	0.947	LIM domain kinase 2
18	9606.ENSP00000348461	0.946	Ras-related C3 botulinum toxin substrate 1
19	9606.ENSP00000446955	0.934	Myosin light polypeptide 6
20	9606.ENSP00000216181	0.932	Myosin-9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0023052	0.991	signaling
GO:0007154	0.989	cell communication
GO:0050794	0.989	regulation of cellular process
GO:0051716	0.988	cellular response to stimulus
GO:0019222	0.984	regulation of metabolic process
GO:0050793	0.965	regulation of developmental process
GO:0016043	0.951	cellular component organization
GO:0048518	0.948	positive regulation of biological process
GO:0007165	0.948	signal transduction
GO:0006996	0.918	organelle organization
GO:0060255	0.908	regulation of macromolecule metabolic process
GO:0048522	0.898	positive regulation of cellular process
GO:0032501	0.896	multicellular organismal process
GO:0048856	0.857	anatomical structure development
GO:0010604	0.856	positive regulation of macromolecule metabolic process
GO:0048519	0.841	negative regulation of biological process
GO:0010468	0.835	regulation of gene expression
GO:0010628	0.820	positive regulation of gene expression
GO:0051128	0.815	regulation of cellular component organization
GO:0051239	0.788	regulation of multicellular organismal process
GO:0007275	0.788	multicellular organism development
GO:0071704	0.735	organic substance metabolic process
GO:0048583	0.714	regulation of response to stimulus
GO:0009719	0.665	response to endogenous stimulus
GO:0051171	0.662	regulation of nitrogen compound metabolic process
GO:0044238	0.638	primary metabolic process
GO:0080090	0.634	regulation of primary metabolic process
GO:0031323	0.602	regulation of cellular metabolic process
GO:0048731	0.601	system development
GO:0065009	0.571	regulation of molecular function
GO:0048523	0.551	negative regulation of cellular process
GO:0044237	0.540	cellular metabolic process
GO:0070848	0.532	response to growth factor
GO:0043170	0.530	macromolecule metabolic process
GO:0051246	0.522	regulation of protein metabolic process
GO:0051173	0.507	positive regulation of nitrogen compound metabolic process
GO:0006807	0.490	nitrogen compound metabolic process
GO:0035556	0.475	intracellular signal transduction
GO:0007010	0.469	cytoskeleton organization
GO:0031325	0.461	positive regulation of cellular metabolic process
GO:0023051	0.436	regulation of signaling
GO:0010646	0.436	regulation of cell communication
GO:0009966	0.431	regulation of signal transduction
GO:0032879	0.416	regulation of localization
GO:0071559	0.410	response to transforming growth factor beta
GO:0009653	0.402	anatomical structure morphogenesis
GO:0048513	0.382	animal organ development
GO:0044087	0.359	regulation of cellular component biogenesis
GO:1902531	0.339	regulation of intracellular signal transduction
GO:0042221	0.326	response to chemical
GO:0019538	0.325	protein metabolic process
GO:0019220	0.321	regulation of phosphate metabolic process
GO:0009889	0.317	regulation of biosynthetic process
GO:0007049	0.305	cell cycle
GO:0033043	0.304	regulation of organelle organization
GO:0051179	0.302	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.839	organelle
GO:0043229	0.832	intracellular organelle
GO:0016020	0.612	membrane
GO:0043227	0.511	membrane-bounded organelle
GO:0043231	0.476	intracellular membrane-bounded organelle
GO:0071944	0.433	cell periphery
GO:0043232	0.382	intracellular non-membrane-bounded organelle
GO:0005886	0.359	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]