StarFunc result for job id O75122

User Input

>input (1294 residues)
MAMGDDKSFDDEESVDGNRPSSAASAFKVPAPKTSGNPANSARKPGSAGGPKVGGASKEG
GAGAVDEDDFIKAFTDVPSIQIYSSRELEETLNKIREILSDDKHDWDQRANALKKIRSLL
VAGAAQYDCFFQHLRLLDGALKLSAKDLRSQVVREACITVAHLSTVLGNKFDHGAEAIVP
TLFNLVPNSAKVMATSGCAAIRFIIRHTHVPRLIPLITSNCTSKSVPVRRRSFEFLDLLL
QEWQTHSLERHAAVLVETIKKGIHDADAEARVEARKTYMGLRNHFPGEAETLYNSLEPSY
QKSLQTYLKSSGSVASLPQSDRSSSSSQESLNRPFSSKWSTANPSTVAGRVSAGSSKASS
LPGSLQRSRSDIDVNAAAGAKAHHAAGQSVRSGRLGAGALNAGSYASLEDTSDKLDGTAS
EDGRVRAKLSAPLAGMGNAKADSRGRSRTKMVSQSQPGSRSGSPGRVLTTTALSTVSSGV
QRVLVNSASAQKRSKIPRSQGCSREASPSRLSVARSSRIPRPSVSQGCSREASRESSRDT
SPVRSFQPLASRHHSRSTGALYAPEVYGASGPGYGISQSSRLSSSVSAMRVLNTGSDVEE
AVADALKKPARRRYESYGMHSDDDANSDASSACSERSYSSRNGSIPTYMRQTEDVAEVLN
RCASSNWSERKEGLLGLQNLLKNQRTLSRVELKRLCEIFTRMFADPHGKRVFSMFLETLV
DFIQVHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRESFPNDLQFNILMRF
TVDQTQTPSLKVKVAILKYIETLAKQMDPGDFINSSETRLAVSRVITWTTEPKSSDVRKA
AQSVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHLRNTGNGTQSSMGSPLTRPTPR
SPANWSSPLTSPTNTSQNTLSPSAFDYDTENMNSEDIYSSLRGVTEAIQNFSFRSQEDMN
EPLKRDSKKDDGDSMCGGPGMSDPRAGGDATDSSQTALDNKASLLHSMPTHSSPRSRDYN
PYNYSDSISPFNKSALKEAMFDDDADQFPDDLSLDHSDLVAELLKELSNHNERVEERKIA
LYELMKLTQEESFSVWDEHFKTILLLLLETLGDKEPTIRALALKVLREILRHQPARFKNY
AELTVMKTLEAHKDPHKEVVRSAEEAASVLATSISPEQCIKVLCPIIQTADYPINLAAIK
MQTKVIERVSKETLNLLLPEIMPGLIQGYDNSESSVRKACVFCLVAVHAVIGDELKPHLS
QLTGSKMKLLNLYIKRAQTGSGGADPTTDVSGQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E3W994	0.237	0.240	0.000	1273	0.983	0.999	E3W994.pdb.gz	E3W994_HUMAN Cytoplasmic linker associated protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=2
2	AFDB:O75122	1.000	1.000	0.000	1294	1.000	1.000	O75122.pdb.gz	CLAP2_HUMAN CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=3
3	AFDB:Q7Z460	0.226	0.197	1.397E-97	1538	0.706	0.594	Q7Z460.pdb.gz	CLAP1_HUMAN CLIP-associating protein 1 OS=Homo sapiens OX=9606 GN=CLASP1 PE=1 SV=1
4	AFDB:Q9NBD7	0.273	0.245	3.535E-50	1491	0.292	0.254	Q9NBD7.pdb.gz	CLASP_DROME CLIP-associating protein OS=Drosophila melanogaster OX=7227 GN=chb PE=1 SV=1
5	AFDB:Q55BD8	0.185	0.263	4.277E-10	899	0.086	0.123	Q55BD8.pdb.gz	Q55BD8_DICDI CLIP-associating protein OS=Dictyostelium discoideum OX=44689 GN=clasp PE=4 SV=1
6	AFDB:Q09933	0.152	0.217	5.026E-9	882	0.111	0.162	Q09933.pdb.gz	DIS1_SCHPO Phosphoprotein p93 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dis1 PE=1 SV=1
7	PDB:4jlqA	0.120	0.175	2.277E-7	840	0.058	0.089	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
8	PDB:1qgkA	0.149	0.198	9.679E-7	876	0.087	0.129	1qgkA.pdb.gz
9	PDB:6xu2A	0.121	0.141	1.047E-6	1091	0.091	0.108	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
10	AFDB:O43432	0.093	0.078	1.067E-6	1585	0.105	0.086	O43432.pdb.gz	IF4G3_HUMAN Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3 PE=1 SV=2
11	AFDB:Q80XI3	0.096	0.081	1.153E-6	1579	0.114	0.093	Q80XI3.pdb.gz	IF4G3_MOUSE Eukaryotic translation initiation factor 4 gamma 3 OS=Mus musculus OX=10090 GN=Eif4g3 PE=1 SV=2
12	PDB:3nd2A	0.144	0.197	1.431E-6	861	0.097	0.146	3nd2A.pdb.gz
13	PDB:7unkA	0.141	0.170	1.810E-6	1047	0.097	0.119	7unkA.pdb.gz
14	PDB:6n1zA	0.133	0.172	2.288E-6	961	0.066	0.088	6n1zA.pdb.gz
15	PDB:3w3uA	0.142	0.171	2.379E-6	1030	0.094	0.118	3w3uA.pdb.gz
16	PDB:4a0cA	0.126	0.139	2.379E-6	1155	0.093	0.104	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
17	PDB:1b3uA	0.132	0.250	3.129E-6	588	0.060	0.131	1b3uA.pdb.gz
18	PDB:5gm6G	0.134	0.189	3.129E-6	875	0.096	0.142	5gm6G.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
19	AFDB:Q8T2I8	0.101	0.109	1.001E-3	1167	0.110	0.122	Q8T2I8.pdb.gz	SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum OX=44689 GN=sepA PE=2 SV=1
20	AFDB:Q9U9A9	0.096	0.109	3.782E-3	1100	0.132	0.155	Q9U9A9.pdb.gz	Q9U9A9_DROME Tuberous sclerosis gene product-1 homolog OS=Drosophila melanogaster OX=7227 GN=Tsc1 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JTD7	0.0	1503	1420	0.645	0.587	A0A0G2JTD7_RAT Cytoplasmic linker associated protein 1 OS=Rattus norvegicus OX=10116 GN=Clasp1 PE=1 SV=2
2	A0A0G2JUI5	0.0	1575	1539	0.674	0.567	A0A0G2JUI5_RAT Cytoplasmic linker associated protein 1 OS=Rattus norvegicus OX=10116 GN=Clasp1 PE=1 SV=2
3	A0A0U1RQI6	0.0	2568	1304	0.978	0.971	A0A0U1RQI6_HUMAN Cytoplasmic linker associated protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=1
4	A0A1B0GWM1	0.0	1640	1478	0.681	0.596	A0A1B0GWM1_RAT Cytoplasmic linker associated protein 1 OS=Rattus norvegicus OX=10116 GN=Clasp1 PE=1 SV=2
5	A0A1B0GWS3	0.0	1637	1247	0.682	0.707	A0A1B0GWS3_RAT Cytoplasmic linker associated protein 1 OS=Rattus norvegicus OX=10116 GN=Clasp1 PE=1 SV=2
6	A0A8I5ZL32	0.0	1610	1495	0.679	0.587	A0A8I5ZL32_RAT Cytoplasmic linker associated protein 1 OS=Rattus norvegicus OX=10116 GN=Clasp1 PE=1 SV=1
7	A0A8I6AEZ5	0.0	1696	1555	0.702	0.585	A0A8I6AEZ5_RAT Cytoplasmic linker associated protein 1 OS=Rattus norvegicus OX=10116 GN=Clasp1 PE=1 SV=1
8	E3W994	0.0	2609	1273	0.984	1.000	E3W994_HUMAN Cytoplasmic linker associated protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=2
9	E7ERI8	0.0	2576	1513	0.979	0.837	E7ERI8_HUMAN Cytoplasmic linker associated protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=1
10	E7EW49	0.0	2571	1514	0.979	0.837	E7EW49_HUMAN Cytoplasmic linker associated protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=1
11	F1LNQ9	0.0	1694	1539	0.701	0.589	F1LNQ9_RAT Cytoplasmic linker associated protein 1 OS=Rattus norvegicus OX=10116 GN=Clasp1 PE=1 SV=4
12	F1LNR0	0.0	1739	1529	0.711	0.602	F1LNR0_RAT Cytoplasmic linker associated protein 1 OS=Rattus norvegicus OX=10116 GN=Clasp1 PE=1 SV=4
13	F1LNR1	0.0	1639	1470	0.680	0.599	F1LNR1_RAT Cytoplasmic linker associated protein 1 OS=Rattus norvegicus OX=10116 GN=Clasp1 PE=1 SV=4
14	J3KR49	0.0	2657	1293	0.999	1.000	J3KR49_HUMAN Cytoplasmic linker associated protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=1
15	O75122	0.0	2664	1294	1.000	1.000	CLAP2_HUMAN CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=3
16	Q7Z460	0.0	1700	1538	0.699	0.588	CLAP1_HUMAN CLIP-associating protein 1 OS=Homo sapiens OX=9606 GN=CLASP1 PE=1 SV=1
17	Q80TV8	0.0	1695	1535	0.699	0.590	CLAP1_MOUSE CLIP-associating protein 1 OS=Mus musculus OX=10090 GN=Clasp1 PE=1 SV=2
18	Q8BRT1	0.0	2401	1286	0.948	0.954	CLAP2_MOUSE CLIP-associating protein 2 OS=Mus musculus OX=10090 GN=Clasp2 PE=1 SV=1
19	Q99JD4	0.0	2523	1286	0.954	0.960	CLAP2_RAT CLIP-associating protein 2 OS=Rattus norvegicus OX=10116 GN=Clasp2 PE=1 SV=1
20	H7C4I5	2.93e-121	376	205	0.145	0.912	H7C4I5_HUMAN Cytoplasmic linker associated protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01602 Adaptin_N	19	15.3	Adaptin N terminal region
2	PF12348 CLASP_N	6.3e-30	116.0	CLASP N terminal
3	PF12717 Cnd1	0.21	23.1	non-SMC mitotic condensation complex subunit 1
4	PF02985 HEAT	3.6e-06	37.7	HEAT repeat
5	PF13646 HEAT_2	0.0023	29.6	HEAT repeats
6	PF13513 HEAT_EZ	0.0006	31.6	HEAT-like repeat
7	PF12333 Ipi1_N	11	18.1	Rix1 complex component involved in 60S ribosome maturation
8	PF12460 MMS19_C	1.9	19.0	RNAPII transcription regulator C-terminal
9	PF14500 MMS19_N	3.9	18.5	Dos2-interacting transcription regulator of RNA-Pol-II
10	PF10274 ParcG	2.2e+02	13.4	Parkin co-regulated protein
11	PF10363 RTP1_C1	0.018	26.5	Required for nuclear transport of RNA pol II C-terminus 1
12	PF12783 Sec7_N	0.84	21.0	Guanine nucleotide exchange factor in Golgi transport N-terminal
13	PF11640 TAN	4.3e+02	12.4	Telomere-length maintenance and DNA damage repair
14	PF12612 TFCD_C	0.79	21.0	Tubulin folding cofactor D C terminal
15	PF12755 Vac14_Fab1_bd	6e+02	12.5	Vacuolar 14 Fab1-binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000417518

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000268182	0.975	Ras GTPase-activating-like protein IQGAP1
2	9606.ENSP00000479322	0.973	CAP-Gly domain-containing linker protein 1
3	9606.ENSP00000364721	0.959	Microtubule-associated protein RP/EB family member 1
4	9606.ENSP00000223398	0.943	CAP-Gly domain-containing linker protein 2
5	9606.ENSP00000432768	0.928	Cytoskeleton-associated protein 5
6	9606.ENSP00000307939	0.869	GRIP and coiled-coil domain-containing protein 2
7	9606.ENSP00000221455	0.849	CLK4-associating serine/arginine rich protein
8	9606.ENSP00000382004	0.840	Catenin delta-1
9	9606.ENSP00000300093	0.738	Serine/threonine-protein kinase PLK1
10	9606.ENSP00000354573	0.727	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5
11	9606.ENSP00000405405	0.715	Pleckstrin homology-like domain family B member 2
12	9606.ENSP00000324806	0.710	Glycogen synthase kinase-3 beta
13	9606.ENSP00000361423	0.691	Tyrosine-protein kinase ABL1
14	9606.ENSP00000427562	0.691	Abelson tyrosine-protein kinase 2
15	9606.ENSP00000385751	0.684	Serine/threonine-protein kinase MARK2
16	9606.ENSP00000233121	0.680	Microtubule-associated protein RP/EB family member 3
17	9606.ENSP00000380378	0.676	Platelet-activating factor acetylhydrolase IB subunit alpha
18	9606.ENSP00000354560	0.649	Kinesin-associated protein 3
19	9606.ENSP00000450832	0.647	Signal-induced proliferation-associated 1-like protein 1
20	9606.ENSP00000389810	0.643	Kinetochore-associated protein DSN1 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008017	0.999	microtubule binding
GO:0051010	0.973	microtubule plus-end binding
GO:0002162	0.929	dystroglycan binding
GO:0019899	0.925	enzyme binding
GO:0003779	0.912	actin binding
GO:0051015	0.892	actin filament binding
GO:1990782	0.890	protein tyrosine kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0070507	0.981	regulation of microtubule cytoskeleton organization
GO:1902903	0.979	regulation of supramolecular fiber organization
GO:0016043	0.969	cellular component organization
GO:0048523	0.956	negative regulation of cellular process
GO:0031109	0.952	microtubule polymerization or depolymerization
GO:0031110	0.938	regulation of microtubule polymerization or depolymerization
GO:0044087	0.925	regulation of cellular component biogenesis
GO:0043244	0.924	regulation of protein-containing complex disassembly
GO:0051129	0.918	negative regulation of cellular component organization
GO:1902904	0.907	negative regulation of supramolecular fiber organization
GO:0051494	0.907	negative regulation of cytoskeleton organization
GO:0043242	0.904	negative regulation of protein-containing complex disassembly
GO:0048522	0.901	positive regulation of cellular process
GO:0007163	0.900	establishment or maintenance of cell polarity
GO:0097435	0.898	supramolecular fiber organization
GO:0051130	0.886	positive regulation of cellular component organization
GO:0030010	0.883	establishment of cell polarity
GO:0031111	0.879	negative regulation of microtubule polymerization or depolymerization
GO:1901880	0.875	negative regulation of protein depolymerization
GO:0043933	0.868	protein-containing complex organization
GO:0044089	0.853	positive regulation of cellular component biogenesis
GO:0031114	0.847	regulation of microtubule depolymerization
GO:0007026	0.844	negative regulation of microtubule depolymerization
GO:0050896	0.829	response to stimulus
GO:0022411	0.815	cellular component disassembly
GO:0060341	0.796	regulation of cellular localization
GO:0050793	0.737	regulation of developmental process
GO:0051716	0.726	cellular response to stimulus
GO:0051179	0.692	localization
GO:0032880	0.683	regulation of protein localization
GO:0007049	0.681	cell cycle
GO:0001952	0.675	regulation of cell-matrix adhesion
GO:0016477	0.672	cell migration
GO:0032970	0.661	regulation of actin filament-based process
GO:0051893	0.660	regulation of focal adhesion assembly
GO:0051641	0.653	cellular localization
GO:0010717	0.648	regulation of epithelial to mesenchymal transition
GO:1903053	0.642	regulation of extracellular matrix organization
GO:0022402	0.641	cell cycle process
GO:0022607	0.635	cellular component assembly
GO:0051234	0.627	establishment of localization
GO:0045995	0.621	regulation of embryonic development
GO:0032984	0.585	protein-containing complex disassembly
GO:0022603	0.582	regulation of anatomical structure morphogenesis
GO:0000278	0.563	mitotic cell cycle
GO:0051261	0.485	protein depolymerization
GO:0032956	0.470	regulation of actin cytoskeleton organization
GO:1903047	0.460	mitotic cell cycle process
GO:0065003	0.460	protein-containing complex assembly
GO:0110053	0.457	regulation of actin filament organization
GO:0051049	0.441	regulation of transport
GO:0032231	0.421	regulation of actin filament bundle assembly
GO:0051649	0.392	establishment of localization in cell
GO:0048583	0.328	regulation of response to stimulus
GO:0007165	0.320	signal transduction
GO:0007051	0.313	spindle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.995	cytosol
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0012505	0.993	endomembrane system
GO:0005794	0.981	Golgi apparatus
GO:0043232	0.979	intracellular non-membrane-bounded organelle
GO:0005856	0.890	cytoskeleton
GO:0016020	0.822	membrane
GO:0099080	0.806	supramolecular complex
GO:0015630	0.806	microtubule cytoskeleton
GO:0071944	0.593	cell periphery
GO:0005886	0.525	plasma membrane
GO:0120025	0.521	plasma membrane bounded cell projection
GO:0000776	0.460	kinetochore
GO:0070013	0.425	intracellular organelle lumen
GO:0031981	0.423	nuclear lumen
GO:0005876	0.401	spindle microtubule
GO:0072686	0.395	mitotic spindle
GO:1990752	0.395	microtubule end
GO:0035371	0.393	microtubule plus-end
GO:0005881	0.391	cytoplasmic microtubule
GO:0005925	0.389	focal adhesion
GO:0005828	0.372	kinetochore microtubule
GO:0044295	0.366	axonal growth cone
GO:1903754	0.366	cortical microtubule plus-end
GO:0045180	0.358	basal cortex
GO:0098791	0.356	Golgi apparatus subcompartment
GO:0005802	0.354	trans-Golgi network
GO:0005654	0.316	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]