StarFunc result for job id O75127

User Input

>input (700 residues)
MDFVRLARLFARARPMGLFILQHLDPCRARWAGGREGLMRPMWAPFSSSSSQLPLGQERQ
ENTGSLGSDPSHSNSTATQEEDEEEEESFGTLSDKYSSRRLFRKSAAQFHNLRFGERRDE
QMEPEPKLWRGRRNTPYWYFLQCKHLIKEGKLVEALDLFERQMLKEERLQPMESNYTVLI
GGCGRVGYLKKAFNLYNQMKKRDLEPSDATYTALFNVCAESPWKDSALQSALKLRQQLQA
KNFELNLKTYHALLKMAAKCADLRMCLDVFKEIIHKGHVVTEETFSFLLMGCIQDKKTGF
RYALQVWRLMLSLGLQPSRDSYNLLLVAARDCGLGDPQVASELLLKPREEATVLQPPVSR
QRPRRTAQAKAGNLMSAMLHVEALERQLFLEPSQALGPPEPPEARVPGKAQPEVDTKAEP
SHTAALTAVALKPPPVELEVNLLTPGAVPPTVVSFGTVTTPADRLALIGGLEGFLSKMAE
HRQQPDIRTLTLLAEVVESGSPAESLLLALLDEHQVEADLTFFNTLVRKKSKLGDLEGAK
ALLPVLAKRGLVPNLQTFCNLAIGCHRPKDGLQLLTDMKKSQVTPNTHIYSALINAAIRK
LNYTYLISILKDMKQNRVPVNEVVIRQLEFAAQYPPTFDRYQGKNTYLEKIDGFRAYYKQ
WLTVMPAEETPHPWQKFRTKPQGDQDTGKEADDGCALGGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75127	1.000	1.000	1.825E-83	700	1.000	1.000	O75127.pdb.gz	PTCD1_HUMAN Pentatricopeptide repeat-containing protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD1 PE=1 SV=2
2	AFDB:Q8C2E4	0.716	0.721	2.471E-59	695	0.734	0.740	Q8C2E4.pdb.gz	PTCD1_MOUSE Pentatricopeptide repeat-containing protein 1, mitochondrial OS=Mus musculus OX=10090 GN=Ptcd1 PE=2 SV=2
3	AFDB:A2VD13	0.762	0.777	1.515E-56	686	0.719	0.733	A2VD13.pdb.gz	PTCD1_RAT Pentatricopeptide repeat-containing protein 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ptcd1 PE=2 SV=1
4	PDB:4m57A	0.206	0.206	4.843E-10	702	0.126	0.125	4m57A.pdb.gz
5	AFDB:F4J741	0.390	0.454	1.527E-9	590	0.110	0.131	F4J741.pdb.gz	F4J741_ARATH Tetratricopeptide repeat (TPR)-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=PPR287 PE=1 SV=1
6	PDB:6sgaF7	0.280	0.293	1.450E-6	662	0.087	0.092	6sgaF7.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
7	PDB:7po24	0.246	0.281	1.042E-5	592	0.096	0.113	7po24.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
8	PDB:6xywAO	0.376	0.545	1.365E-5	452	0.104	0.162	6xywAO.pdb.gz	Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.
9	PDB:7pnt4	0.230	0.265	1.860E-5	589	0.099	0.117	7pnt4.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
10	AFDB:Q9ZQE5	0.213	0.253	2.101E-4	579	0.087	0.105	Q9ZQE5.pdb.gz	PP153_ARATH Pentatricopeptide repeat-containing protein At2g15690, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PCMP-H66 PE=1 SV=2
11	AFDB:E5FYH1	0.176	0.099	3.093E-4	1653	0.124	0.053	E5FYH1.pdb.gz	TOPZ1_MOUSE Protein TOPAZ1 OS=Mus musculus OX=10090 GN=Topaz1 PE=2 SV=1
12	PDB:6yxxE6	0.240	0.354	3.653E-4	434	0.067	0.108	6yxxE6.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
13	AFDB:E1B8W3	0.178	0.137	5.315E-4	1044	0.113	0.076	E1B8W3.pdb.gz	ODAD2_BOVIN Outer dynein arm-docking complex subunit 2 OS=Bos taurus OX=9913 GN=ODAD2 PE=1 SV=3
14	PDB:7a9wA	0.283	0.359	6.277E-4	513	0.091	0.125	7a9wA.pdb.gz	The pentatricopeptide repeat protein Rmd9 recognizes the dodecameric element in the 3'-UTRs of yeast mitochondrial mRNAs.
15	AFDB:B0BF33	0.170	0.151	7.242E-4	815	0.127	0.109	B0BF33.pdb.gz	PKP2_DANRE Plakophilin-2 OS=Danio rerio OX=7955 GN=pkp2 PE=2 SV=1
16	AFDB:D3YUP5	0.107	0.099	1.510E-3	789	0.133	0.118	D3YUP5.pdb.gz	D3YUP5_MOUSE Exocyst complex component 3-like 2 OS=Mus musculus OX=10090 GN=Exoc3l2 PE=1 SV=2
17	PDB:7puaFX	0.216	0.608	2.002E-3	220	0.047	0.150	7puaFX.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
18	PDB:6zs9A4	0.231	0.277	2.337E-3	558	0.111	0.140	6zs9A4.pdb.gz	Structural basis of mitochondrial translation.
19	PDB:7pubFO	0.177	0.376	2.728E-3	267	0.053	0.139	7pubFO.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
20	AFDB:E7FB07	0.197	0.149	4.289E-3	1047	0.131	0.088	E7FB07.pdb.gz	E7FB07_DANRE Armadillo repeat containing 4 OS=Danio rerio OX=7955 GN=armc4 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2VD13	0.0	998	686	0.724	0.739	PTCD1_RAT Pentatricopeptide repeat-containing protein 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ptcd1 PE=2 SV=1
2	O75127	0.0	1446	700	1.000	1.000	PTCD1_HUMAN Pentatricopeptide repeat-containing protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD1 PE=1 SV=2
3	Q8C2E4	0.0	1011	695	0.731	0.737	PTCD1_MOUSE Pentatricopeptide repeat-containing protein 1, mitochondrial OS=Mus musculus OX=10090 GN=Ptcd1 PE=2 SV=2
4	Q9FMQ1	1.64e-18	92.4	816	0.179	0.153	PP376_ARATH Pentatricopeptide repeat-containing protein At5g12100, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g12100 PE=2 SV=1
5	O64624	5.53e-13	74.7	822	0.154	0.131	PP163_ARATH Pentatricopeptide repeat-containing protein At2g18940, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At2g18940 PE=2 SV=1
6	Q9SAK0	7.81e-13	74.3	836	0.093	0.078	PP132_ARATH Pentatricopeptide repeat-containing protein At1g79490, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=EMB2217 PE=2 SV=1
7	B8Y6I0	3.35e-11	68.9	786	0.131	0.117	PPR10_MAIZE Pentatricopeptide repeat-containing protein 10, chloroplastic OS=Zea mays OX=4577 GN=PPR10 PE=1 SV=1
8	Q0WKV3	1.37e-10	67.0	637	0.071	0.078	PPR36_ARATH Pentatricopeptide repeat-containing protein At1g12300, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g12300 PE=2 SV=1
9	Q8RWS8	2.60e-10	66.2	822	0.149	0.127	PP199_ARATH Pentatricopeptide repeat-containing protein At2g41720 OS=Arabidopsis thaliana OX=3702 GN=EMB2654 PE=2 SV=1
10	Q9FIX3	5.36e-10	65.1	747	0.074	0.070	PP407_ARATH Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana OX=3702 GN=EMB2745 PE=2 SV=1
11	Q9LQ16	1.75e-09	63.5	632	0.073	0.081	PPR94_ARATH Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana OX=3702 GN=At1g62910 PE=2 SV=1
12	Q9SZ52	2.21e-09	63.5	1112	0.147	0.093	PP344_ARATH Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PGR3 PE=1 SV=1
13	Q9T0D6	3.38e-09	62.4	566	0.076	0.094	PP306_ARATH Pentatricopeptide repeat-containing protein At4g11690 OS=Arabidopsis thaliana OX=3702 GN=At4g11690 PE=2 SV=1
14	Q9ASZ8	3.86e-09	62.4	621	0.151	0.171	PPR37_ARATH Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana OX=3702 GN=At1g12620 PE=2 SV=1
15	Q9SXD1	4.75e-09	62.0	630	0.073	0.081	PPR91_ARATH Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g62670 PE=3 SV=2
16	Q9ZU27	6.96e-09	61.6	650	0.063	0.068	PPR76_ARATH Pentatricopeptide repeat-containing protein At1g51965, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g51965 PE=2 SV=1
17	P0C7Q7	8.97e-09	61.2	602	0.064	0.075	PPR38_ARATH Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g12700 PE=3 SV=1
18	F4IJS7	1.52e-08	60.5	613	0.067	0.077	F4IJS7_ARATH Tetratricopeptide repeat (TPR)-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=PPR_66 PE=1 SV=1
19	Q9SIC9	1.76e-08	60.5	918	0.070	0.053	PP178_ARATH Pentatricopeptide repeat-containing protein GUN1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GUN1 PE=2 SV=1
20	Q0WVK7	1.78e-08	60.1	741	0.147	0.139	PPR12_ARATH Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g05670 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13762 MNE1	2.1e+02	13.3	Mitochondrial splicing apparatus component
2	PF01535 PPR	3.7e-12	56.7	PPR repeat
3	PF12854 PPR_1	0.027	25.5	PPR repeat
4	PF13041 PPR_2	6.8e-31	117.5	PPR repeat family
5	PF13812 PPR_3	6e-21	85.6	Pentatricopeptide repeat domain
6	PF17177 PPR_long	1.6e-15	68.6	Pentacotripeptide-repeat region of PRORP

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000292478

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000254630	0.838	Pentatricopeptide repeat domain-containing protein 3, mitochondrial
2	9606.ENSP00000370013	0.833	Pentatricopeptide repeat-containing protein 2, mitochondrial
3	9606.ENSP00000236980	0.791	FAST kinase domain-containing protein 2, mitochondrial
4	9606.ENSP00000465759	0.788	DNA-directed RNA polymerase, mitochondrial
5	9606.ENSP00000260665	0.776	Leucine-rich PPR motif-containing protein, mitochondrial
6	9606.ENSP00000287025	0.773	Transcription termination factor 3, mitochondrial
7	9606.ENSP00000332340	0.764	Probable ATP-dependent RNA helicase DDX28
8	9606.ENSP00000440915	0.725	Mitochondrial ribonuclease P catalytic subunit
9	9606.ENSP00000417602	0.707	Belongs to the universal ribosomal protein uL29 family.
10	9606.ENSP00000258975	0.702	Translational activator of cytochrome c oxidase 1
11	9606.ENSP00000264669	0.696	FAST kinase domain-containing protein 3, mitochondrial
12	9606.ENSP00000254799	0.685	G-rich sequence factor 1
13	9606.ENSP00000308897	0.683	Mitochondrial ribosomal protein L11
14	9606.ENSP00000426941	0.675	28S ribosomal protein S27, mitochondrial
15	9606.ENSP00000354499	0.671	Cytochrome c oxidase subunit 1
16	9606.ENSP00000481559	0.671	rRNA methyltransferase 1, mitochondrial
17	9606.ENSP00000354554	0.669	Cytochrome b
18	9606.ENSP00000406327	0.669	Cytochrome c oxidase protein 20 homolog
19	9606.ENSP00000450909	0.662	SRA stem-loop-interacting RNA-binding protein, mitochondrial
20	9606.ENSP00000312356	0.657	tRNA methyltransferase 10 homolog C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000049	1.000	tRNA binding
GO:0003729	0.519	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.998	primary metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0006807	0.996	nitrogen compound metabolic process
GO:0034641	0.993	cellular nitrogen compound metabolic process
GO:0010467	0.991	gene expression
GO:1901360	0.976	organic cyclic compound metabolic process
GO:0016070	0.972	RNA metabolic process
GO:0006396	0.942	RNA processing
GO:0034660	0.831	ncRNA metabolic process
GO:0034470	0.526	ncRNA processing
GO:0006399	0.488	tRNA metabolic process
GO:0008033	0.447	tRNA processing
GO:0031123	0.387	RNA 3'-end processing
GO:0140053	0.361	mitochondrial gene expression
GO:1901564	0.327	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0070013	0.945	intracellular organelle lumen
GO:0005759	0.830	mitochondrial matrix
GO:0016020	0.635	membrane
GO:0031981	0.491	nuclear lumen
GO:0005654	0.467	nucleoplasm
GO:0032991	0.365	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]