StarFunc result for job id O75128

User Input

>input (1261 residues)
MDAPRASAAKPPTGRKMKARAPPPPGKAATLHVHSDQKPPHDGALGSQQNLVRMKEALRA
STMDVTVVLPSGLEKRSVLNGSHAMMDLLVELCLQNHLNPSHHALEIRSSETQQPLSFKP
NTLIGTLNVHTVFLKEKVPEEKVKPGPPKVPEKSVRLVVNYLRTQKAVVRVSPEVPLQNI
LPVICAKCEVSPEHVVLLRDNIAGEELELSKSLNELGIKELYAWDNRRETFRKSSLGNDE
TDKEKKKFLGFFKVNKRSNSKGCLTTPNSPSMHSRSLTLGPSLSLGSISGVSVKSEMKKR
RAPPPPGSGPPVQDKASEKVSLGSQIDLQKKKRRAPAPPPPQPPPPSPLIPNRTEDKEEN
RKSTMVSLPLGSGSHCSPDGAPQVLSEAEETVSVGSCFASEDTTEDSGVMSSPSDIVSLD
SQQDSMKYKDKWATDQEDCSDQDLAGTPDLGPQKSPLWEKNGSENSHLRTEKAVTASNDE
EDLLIAGEFRKTLAELDEDLEEMEDSYETDTSSLTSSIHGASNHCPQDAMIPHGDTDAIP
VTFIGEVSDDPVDSGLFSNRNNNAGSFDSEGVASRRDSLAPLQAEHSQPHEKAREEVPAL
HPASHDVGKGIRVALSNISKDGNLMETAPRVTSFASNLHTDNLNAKVKDKVYGCADGERT
QATERVNSQPVNEKDSNDKNAALAPTSWHQRGQNPGKSYRLKHGLTTYKIIPPKSEMRCY
DRDVSLSTGAIKIDELGNLVSPHATGIRIISLSSSVPEAESQPIGKVREFWRCNSVEKHL
GRPSESSARGPPSTPVPTQTQNPESRLQADPKPISPQQKSAHHEGRNPLGEGRNQPPTMG
MGHVRVPAAHTTEVTFLKPQRRTSSQYVASAIAKRIGAPKVHADVVRPHGYAEKGYAGKA
PVLAAPPVTVKDDRTSSPHSETQGWKDGAQWPCVTPPNNHGEDLAVGAPPRGEVIGPHRK
LSTQDRPAAIHRSSCFSLVQSSQRDRVSVGQSCGFSGKQSTSSQEASSASEPRRAPDGTD
PPPPHTSDTQACSRELVNGSVRAPGHGEPSHPPGGSGTESHILLEREEKPSVFSTDGNET
DSIWPPSIFGPKKKFKPVVQRPVPKDTSLHSALMEAIHSAGGKDRLRKTAEHTGEGRPAK
LSYTEAEGERSALLAAIRGHSGTCSLRKVASSASEELQSFRDAALSAQGSESPLLEDLGL
LSPPAIPPPPPPPSQALSAPRTASRFSTGTLSNTADARQALMDAIRSGTGAARLRKVPLL
V

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75128	1.000	1.000	0.000	1261	1.000	1.000	O75128.pdb.gz	COBL_HUMAN Protein cordon-bleu OS=Homo sapiens OX=9606 GN=COBL PE=1 SV=2
2	AFDB:Q5NBX1	0.248	0.237	0.000	1337	0.670	0.632	Q5NBX1.pdb.gz	COBL_MOUSE Protein cordon-bleu OS=Mus musculus OX=10090 GN=Cobl PE=1 SV=1
3	AFDB:D3ZUI5	0.267	0.292	1.012E-103	1133	0.572	0.636	D3ZUI5.pdb.gz	COBL_RAT Protein cordon-bleu OS=Rattus norvegicus OX=10116 GN=Cobl PE=1 SV=1
4	AFDB:E7F568	0.139	0.132	1.890E-50	1343	0.325	0.305	E7F568.pdb.gz	COBL_DANRE Protein cordon-bleu OS=Danio rerio OX=7955 GN=cobl PE=1 SV=2
5	AFDB:Q53SF7	0.104	0.114	2.781E-33	1128	0.209	0.234	Q53SF7.pdb.gz	COBL1_HUMAN Cordon-bleu protein-like 1 OS=Homo sapiens OX=9606 GN=COBLL1 PE=1 SV=3
6	PDB:7rbsB	0.056	0.414	6.995E-10	157	0.019	0.153	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
7	PDB:6yvaC	0.056	0.406	9.667E-10	155	0.017	0.142	6yvaC.pdb.gz
8	PDB:7lq1A	0.064	0.081	2.158E-8	950	0.021	0.028	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
9	PDB:6mdhA	0.056	0.440	2.456E-8	149	0.013	0.114	6mdhA.pdb.gz
10	PDB:5dxhD	0.064	0.078	7.870E-8	981	0.024	0.031	5dxhD.pdb.gz	The Rational Design of Selective Benzoxazepin Inhibitors of the alpha-Isoform of Phosphoinositide 3-Kinase Culminating in the Identification of (S)-2-((2-(1-Isopropyl-1H-1,2,4-triazol-5-yl)-5,6-dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepin-9-yl)oxy)propanamide (GDC-0326).
11	PDB:5itdA	0.064	0.077	1.711E-7	995	0.024	0.030	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.
12	PDB:2y3aA	0.069	0.085	1.825E-7	976	0.019	0.025	2y3aA.pdb.gz	Structure of Lipid Kinase P110Beta-P85Beta Elucidates an Unusual Sh2-Domain-Mediated Inhibitory Mechanism.
13	PDB:6pyuA	0.066	0.084	2.216E-7	930	0.021	0.029	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.
14	AFDB:P35820	0.061	0.050	2.550E-7	1601	0.156	0.123	P35820.pdb.gz	PSC_DROME Polycomb group protein Psc OS=Drosophila melanogaster OX=7227 GN=Psc PE=1 SV=2
15	PDB:4yknA	0.061	0.063	3.718E-7	1205	0.031	0.032	4yknA.pdb.gz	Discovery of a Potent Class of PI3K alpha Inhibitors with Unique Binding Mode via Encoded Library Technology (ELT).
16	PDB:5swpA	0.065	0.075	3.718E-7	1060	0.021	0.025	5swpA.pdb.gz	Identification of allosteric binding sites for PI3K alpha oncogenic mutant specific inhibitor design.
17	AFDB:Q8IWN7	0.063	0.040	9.552E-6	2400	0.155	0.081	Q8IWN7.pdb.gz	RP1L1_HUMAN Retinitis pigmentosa 1-like 1 protein OS=Homo sapiens OX=9606 GN=RP1L1 PE=1 SV=5
18	AFDB:Q8CGM2	0.080	0.062	1.646E-4	1859	0.152	0.103	Q8CGM2.pdb.gz	RP1L1_MOUSE Retinitis pigmentosa 1-like 1 protein OS=Mus musculus OX=10090 GN=Rp1l1 PE=1 SV=1
19	AFDB:P56716	0.055	0.037	4.944E-4	2095	0.121	0.073	P56716.pdb.gz	RP1_MOUSE Oxygen-regulated protein 1 OS=Mus musculus OX=10090 GN=Rp1 PE=1 SV=2
20	AFDB:Q8SXD4	0.059	0.066	4.944E-4	1122	0.121	0.136	Q8SXD4.pdb.gz	MIDN_DROME Midnolin homolog OS=Drosophila melanogaster OX=7227 GN=stx PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZUI5	0.0	708	1133	0.339	0.377	COBL_RAT Protein cordon-bleu OS=Rattus norvegicus OX=10116 GN=Cobl PE=1 SV=1
2	G5E8P4	0.0	922	1312	0.421	0.405	G5E8P4_MOUSE Cordon-bleu WH2 repeat OS=Mus musculus OX=10090 GN=Cobl PE=1 SV=1
3	O75128	0.0	2571	1261	1.000	1.000	COBL_HUMAN Protein cordon-bleu OS=Homo sapiens OX=9606 GN=COBL PE=1 SV=2
4	Q5NBX1	0.0	922	1337	0.421	0.397	COBL_MOUSE Protein cordon-bleu OS=Mus musculus OX=10090 GN=Cobl PE=1 SV=1
5	E7F568	2.92e-60	229	1343	0.101	0.095	COBL_DANRE Protein cordon-bleu OS=Danio rerio OX=7955 GN=cobl PE=1 SV=2
6	Q53SF7	8.52e-53	205	1128	0.096	0.107	COBL1_HUMAN Cordon-bleu protein-like 1 OS=Homo sapiens OX=9606 GN=COBLL1 PE=1 SV=3
7	Q7XTK3	3.9	33.9	435	0.013	0.037	AMI1_ORYSJ Amidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=AMI1 PE=1 SV=1
8	Q5BJU7	4.9	33.9	559	0.017	0.039	WASF1_RAT Actin-binding protein WASF1 OS=Rattus norvegicus OX=10116 GN=Wasf1 PE=1 SV=1
9	Q8R5H6	4.9	33.9	559	0.017	0.039	WASF1_MOUSE Actin-binding protein WASF1 OS=Mus musculus OX=10090 GN=Wasf1 PE=1 SV=2
10	Q92558	9.1	32.7	559	0.017	0.038	WASF1_HUMAN Actin-binding protein WASF1 OS=Homo sapiens OX=9606 GN=WASF1 PE=1 SV=1
11	A0A1D8PEG3	9.9	32.7	936	0.029	0.038	A0A1D8PEG3_CANAL Kexin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=KEX2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09469 Cobl	3.1e-44	160.6	Cordon-bleu ubiquitin-like domain
2	PF02196 RBD	9.1	17.6	Raf-like Ras-binding domain
3	PF02205 WH2	4.6e-16	69.3	WH2 motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000032797

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000006177	0.805	Protein kinase C and casein kinase substrate in neurons 3
2	9598.ENSPTRP00000024917	0.797	Protein kinase C and casein kinase substrate in neurons 2
3	9598.ENSPTRP00000051418	0.784	Uncharacterized protein
4	9598.ENSPTRP00000060101	0.730	Uncharacterized protein
5	9598.ENSPTRP00000030854	0.701	Protein kinase C and casein kinase substrate in neurons 1
6	9598.ENSPTRP00000021722	0.679	Sperm specific antigen 2
7	9598.ENSPTRP00000032790	0.629	Uncharacterized protein
8	9598.ENSPTRP00000009109	0.604	Coiled-coil domain containing 53
9	9598.ENSPTRP00000029153	0.603	Junction mediating and regulatory protein, p53 cofactor
10	9598.ENSPTRP00000059240	0.597	Growth factor receptor-bound protein 10
11	9598.ENSPTRP00000000924	0.584	Pan troglodytes proteasome (prosome, macropain) subunit, beta type, 2 (PSMB2), mRNA
12	9598.ENSPTRP00000005982	0.549	Developing brain homeobox 1
13	9598.ENSPTRP00000047657	0.534	Leiomodin 2 (cardiac)
14	9598.ENSPTRP00000032682	0.524	Uncharacterized protein
15	9598.ENSPTRP00000037189	0.509	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.591	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050789	0.976	regulation of biological process
GO:0050794	0.969	regulation of cellular process
GO:0071840	0.965	cellular component organization or biogenesis
GO:0016043	0.954	cellular component organization
GO:0048522	0.944	positive regulation of cellular process
GO:0007399	0.938	nervous system development
GO:0006996	0.902	organelle organization
GO:0007010	0.872	cytoskeleton organization
GO:0030029	0.834	actin filament-based process
GO:0097435	0.798	supramolecular fiber organization
GO:0030036	0.783	actin cytoskeleton organization
GO:0051128	0.779	regulation of cellular component organization
GO:0022607	0.734	cellular component assembly
GO:0007015	0.629	actin filament organization
GO:0120036	0.498	plasma membrane bounded cell projection organization
GO:0051130	0.496	positive regulation of cellular component organization
GO:0044089	0.452	positive regulation of cellular component biogenesis
GO:0120035	0.437	regulation of plasma membrane bounded cell projection organization
GO:0065003	0.430	protein-containing complex assembly
GO:0048666	0.400	neuron development
GO:0000902	0.398	cell morphogenesis
GO:0032989	0.388	cellular component morphogenesis
GO:0031175	0.388	neuron projection development
GO:0048812	0.372	neuron projection morphogenesis
GO:0000904	0.371	cell morphogenesis involved in differentiation
GO:0016331	0.367	morphogenesis of embryonic epithelium
GO:0030041	0.367	actin filament polymerization
GO:0021915	0.366	neural tube development
GO:0072175	0.366	epithelial tube formation
GO:0048667	0.360	cell morphogenesis involved in neuron differentiation
GO:0048513	0.348	animal organ development
GO:0048568	0.342	embryonic organ development
GO:0001843	0.327	neural tube closure
GO:0033504	0.313	floor plate development
GO:0031346	0.304	positive regulation of cell projection organization
GO:0035282	0.301	segmentation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0005938	0.999	cell cortex
GO:0016020	0.994	membrane
GO:0043232	0.983	intracellular non-membrane-bounded organelle
GO:0043227	0.973	membrane-bounded organelle
GO:0005856	0.959	cytoskeleton
GO:0005886	0.927	plasma membrane
GO:0043231	0.889	intracellular membrane-bounded organelle
GO:0005634	0.724	nucleus
GO:0005829	0.695	cytosol
GO:0015629	0.689	actin cytoskeleton
GO:0031981	0.367	nuclear lumen
GO:0031982	0.366	vesicle
GO:0070062	0.329	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]