StarFunc result for job id O75129

User Input

>input (1339 residues)
MAAAGARLSPGPGSGLRGRPRLCFHPGPPPLLPLLLLFLLLLPPPPLLAGATAAASREPD
SPCRLKTVTVSTLPALRESDIGWSGARAGAGAGTGAGAAAAAASPGSPGSAGTAAESRLL
LFVRNELPGRIAVQDDLDNTELPFFTLEMSGTAADISLVHWRQQWLENGTLYFHVSMSSS
GQLAQATAPTLQEPSEIVEEQMHILHISVMGGLIALLLLLLVFTVALYAQRRWQKRRRIP
QKSASTEATHEIHYIPSVLLGPQARESFRSSRLQTHNSVIGVPIRETPILDDYDCEEDEE
PPRRANHVSREDEFGSQVTHTLDSLGHPGEEKVDFEKKAAAEATQETVESLMQKFKESFR
ANTPIEIGQLQPPLRSTSAGKRKRRSKSRGGISFGRAKGTSGSEADDETQLTFYTEQYRS
RRRSKGLLKSPVNKTALTLIAVSSCILAMVCGSQMSCPLTVKVTLHVPEHFIADGSSFVV
SEGSYLDISDWLNPAKLSLYYQINATSPWVRDLCGQRTTDACEQLCDPETGECSCHEGYA
PDPVHRHLCVRSDWGQSEGPWPYTTLERGYDLVTGEQAPEKILRSTFSLGQGLWLPVSKS
FVVPPVELSINPLASCKTDVLVTEDPADVREEAMLSTYFETINDLLSSFGPVRDCSRNNG
GCTRNFKCVSDRQVDSSGCVCPEELKPMKDGSGCYDHSKGIDCSDGFNGGCEQLCLQQTL
PLPYDATSSTIFMFCGCVEEYKLAPDGKSCLMLSDVCEGPKCLKPDSKFNDTLFGEMLHG
YNNRTQHVNQGQVFQMTFRENNFIKDFPQLADGLLVIPLPVEEQCRGVLSEPLPDLQLLT
GDIRYDEAMGYPMVQQWRVRSNLYRVKLSTITLAAGFTNVLKILTKESSREELLSFIQHY
GSHYIAEALYGSELTCIIHFPSKKVQQQLWLQYQKETTELGSKKELKSMPFITYLSGLLT
AQMLSDDQLISGVEIRCEEKGRCPSTCHLCRRPGKEQLSPTPVLLEINRVVPLYTLIQDN
GTKEAFKSALMSSYWCSGKGDVIDDWCRCDLSAFDANGLPNCSPLLQPVLRLSPTVEPSS
TVVSLEWVDVQPAIGTKVSDYILQHKKVDEYTDTDLYTGEFLSFADDLLSGLGTSCVAAG
RSHGEVPEVSIYSVIFKCLEPDGLYKFTLYAVDTRGRHSELSTVTLRTACPLVDDNKAEE
IADKIYNLYNGYTSGKEQQMAYNTLMEVSASMLFRVQHHYNSHYEKFGDFVWRSEDELGP
RKAHLILRRLERVSSHCSSLLRSAYIQSRVETVPYLFCRSEEVRPAGMVWYSILKDTKIT
CEEKMVSMARNTYGESKGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3nsjA	0.148	0.328	5.689E-12	530	0.053	0.134	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
2	PDB:6u2lA	0.143	0.281	3.851E-11	613	0.053	0.116	6u2lA.pdb.gz
3	PDB:6u23A	0.135	0.282	1.148E-10	583	0.050	0.115	6u23A.pdb.gz
4	PDB:6sb3A	0.141	0.285	4.004E-9	604	0.055	0.123	6sb3A.pdb.gz
5	PDB:3ojyB	0.152	0.361	1.569E-8	504	0.043	0.113	3ojyB.pdb.gz	Structure of human C8 protein provides mechanistic insight into membrane pore formation by complement.
6	PDB:3t5oA	0.139	0.199	2.430E-8	871	0.052	0.079	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
7	PDB:8a1dA	0.124	0.289	8.538E-8	533	0.051	0.128	8a1dA.pdb.gz	Cryo-EM structures of perforin-2 in isolation and assembled on a membrane suggest a mechanism for pore formation.
8	PDB:4e0sB	0.148	0.210	1.185E-7	898	0.048	0.071	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
9	PDB:7nydE	0.117	0.296	2.128E-5	484	0.037	0.103	7nydE.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
10	PDB:7nycD	0.114	0.289	2.796E-5	487	0.040	0.109	7nycD.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
11	AFDB:B7YZW3	0.068	0.046	3.336E-5	2064	0.102	0.066	B7YZW3.pdb.gz	B7YZW3_DROME Miles to go, isoform E OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=1
12	AFDB:A0A0B4KFZ2	0.061	0.068	8.316E-3	1161	0.092	0.106	A0A0B4KFZ2.pdb.gz	A0A0B4KFZ2_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=CG31123 PE=1 SV=1
13	AFDB:Q583D6	0.045	0.043	8.316E-3	1471	0.116	0.105	Q583D6.pdb.gz	Q583D6_TRYB2 Protein phosphatase 2C, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3I12.880 PE=3 SV=1
14	AFDB:Q8TEP8	0.064	0.038	1.287E-2	2537	0.094	0.050	Q8TEP8.pdb.gz	CE192_HUMAN Centrosomal protein of 192 kDa OS=Homo sapiens OX=9606 GN=CEP192 PE=1 SV=3
15	AFDB:Q54NE5	0.045	0.035	4.283E-2	1918	0.099	0.069	Q54NE5.pdb.gz	Q54NE5_DICDI Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0285313 PE=4 SV=1
16	AFDB:Q91XX1	0.045	0.061	5.945E-2	934	0.025	0.036	Q91XX1.pdb.gz	Q91XX1_MOUSE Protocadherin gamma C3 OS=Mus musculus OX=10090 GN=Pcdhgc3 PE=1 SV=1
17	AFDB:O95487	0.061	0.064	8.251E-2	1268	0.115	0.121	O95487.pdb.gz	SC24B_HUMAN Protein transport protein Sec24B OS=Homo sapiens OX=9606 GN=SEC24B PE=1 SV=2
18	AFDB:Q9VHC4	0.055	0.063	8.714E-2	1133	0.087	0.103	Q9VHC4.pdb.gz	Q9VHC4_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=FCHo2 PE=1 SV=3
19	AFDB:Q91XY7	0.043	0.059	1.277E-1	932	0.024	0.034	Q91XY7.pdb.gz	Q91XY7_MOUSE Protocadherin gamma A12 OS=Mus musculus OX=10090 GN=Pcdhga12 PE=1 SV=1
20	AFDB:E9QG91	0.053	0.045	1.349E-1	1719	0.119	0.092	E9QG91.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0Y3A8	0.0	2206	1062	0.793	1.000	H0Y3A8_HUMAN Astrotactin 2 (Fragment) OS=Homo sapiens OX=9606 GN=ASTN2 PE=1 SV=1
2	O14525	0.0	1262	1302	0.490	0.504	ASTN1_HUMAN Astrotactin-1 OS=Homo sapiens OX=9606 GN=ASTN1 PE=1 SV=3
3	O75129	0.0	2773	1339	1.000	1.000	ASTN2_HUMAN Astrotactin-2 OS=Homo sapiens OX=9606 GN=ASTN2 PE=1 SV=2
4	Q61137	0.0	1262	1302	0.490	0.504	ASTN1_MOUSE Astrotactin-1 OS=Mus musculus OX=10090 GN=Astn1 PE=1 SV=4
5	Q80Z10	0.0	2684	1352	0.977	0.967	ASTN2_MOUSE Astrotactin-2 OS=Mus musculus OX=10090 GN=Astn2 PE=1 SV=2
6	Q9NZR2	0.11	39.7	4599	0.025	0.007	LRP1B_HUMAN Low-density lipoprotein receptor-related protein 1B OS=Homo sapiens OX=9606 GN=LRP1B PE=1 SV=2
7	P01133	0.21	38.5	1207	0.025	0.028	EGF_HUMAN Pro-epidermal growth factor OS=Homo sapiens OX=9606 GN=EGF PE=1 SV=2
8	Q8HZ48	0.21	38.5	580	0.024	0.055	Q8HZ48_RABIT Thrombomodulin OS=Oryctolagus cuniculus OX=9986 GN=Thbd PE=2 SV=2
9	F1S0M0	0.25	38.1	879	0.028	0.042	F1S0M0_PIG Matrilin 2 OS=Sus scrofa OX=9823 GN=MATN2 PE=1 SV=4
10	Q9NQ36	0.26	38.1	999	0.025	0.033	SCUB2_HUMAN Signal peptide, CUB and EGF-like domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SCUBE2 PE=1 SV=3
11	Q00918	0.49	37.4	1712	0.043	0.033	LTBP1_RAT Latent-transforming growth factor beta-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ltbp1 PE=1 SV=1
12	Q07954	0.53	37.4	4544	0.025	0.007	LRP1_HUMAN Prolow-density lipoprotein receptor-related protein 1 OS=Homo sapiens OX=9606 GN=LRP1 PE=1 SV=2
13	Q9JJS0	0.60	37.0	997	0.025	0.033	SCUB2_MOUSE Signal peptide, CUB and EGF-like domain-containing protein 2 OS=Mus musculus OX=10090 GN=Scube2 PE=1 SV=1
14	Q6NZL8	0.71	37.0	1018	0.043	0.056	SCUB1_MOUSE Signal peptide, CUB and EGF-like domain-containing protein 1 OS=Mus musculus OX=10090 GN=Scube1 PE=2 SV=2
15	M9PHP7	0.96	36.6	1427	0.026	0.025	M9PHP7_DROME Faulty attraction, isoform F OS=Drosophila melanogaster OX=7227 GN=frac PE=4 SV=1
16	Q8CFM6	0.97	36.2	1431	0.038	0.036	STAB2_RAT Stabilin-2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Stab2 PE=1 SV=1
17	Q8IWY4	1.1	36.2	988	0.022	0.030	SCUB1_HUMAN Signal peptide, CUB and EGF-like domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SCUBE1 PE=1 SV=3
18	P15306	1.5	35.4	577	0.022	0.052	TRBM_MOUSE Thrombomodulin OS=Mus musculus OX=10090 GN=Thbd PE=1 SV=1
19	Q61555	1.6	35.8	2907	0.028	0.013	FBN2_MOUSE Fibrillin-2 OS=Mus musculus OX=10090 GN=Fbn2 PE=1 SV=2
20	P35556	1.7	35.8	2912	0.028	0.013	FBN2_HUMAN Fibrillin-2 OS=Homo sapiens OX=9606 GN=FBN2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18411 Annexin_like	3.7e-52	185.9	Annexin-like domain
2	PF19743 ASTN1_2_EGF_Fn	1.2e-123	422.6	ASTN1/2 EGF-like and Fn(III) domains
3	PF19441 ASTN_1_2_N	5.2e-177	601.3	Astrotactin 1/2 N-terminal
4	PF18577 ASTN_2_hairpin	1.1e-24	97.5	Astrotactin-2 C-terminal beta-hairpin domain
5	PF12662 cEGF	15	16.9	Complement Clr-like EGF-like
6	PF14670 FXa_inhibition	2.1e-07	42.4	Coagulation Factor Xa inhibitory site
7	PF01823 MACPF	0.0013	30.5	MAC/Perforin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9544.ENSMMUP00000039777

Rank	PPI partner	STRING score	Description
1	9544.ENSMMUP00000019879	0.792	Adaptor-related protein complex 4, epsilon 1 subunit
2	9544.ENSMMUP00000035508	0.791	Aminoacyl tRNA synthetase complex-interacting multifunctional protein 2
3	9544.ENSMMUP00000003853	0.771	N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4
4	9544.ENSMMUP00000010089	0.763	Uncharacterized protein
5	9544.ENSMMUP00000007617	0.743	H/ACA ribonucleoprotein complex subunit 4 isoform 1
6	9544.ENSMMUP00000016643	0.743	Myosin X
7	9544.ENSMMUP00000018256	0.704	NOP56 ribonucleoprotein
8	9544.ENSMMUP00000027947	0.700	H/ACA ribonucleoprotein complex subunit
9	9544.ENSMMUP00000028393	0.676	Junctional cadherin 5 associated
10	9544.ENSMMUP00000006707	0.670	Cyclin dependent kinase like 5
11	9544.ENSMMUP00000029923	0.661	Fibrillarin
12	9544.ENSMMUP00000037964	0.660	Ubiquitin carboxyl-terminal hydrolase
13	9544.ENSMMUP00000019623	0.632	Nuclear receptor subfamily 3 group C member 2
14	9544.ENSMMUP00000022670	0.632	acyl-CoA synthetase family member 2
15	9544.ENSMMUP00000020088	0.615	Potassium voltage-gated channel subfamily Q member 5
16	9544.ENSMMUP00000021210	0.615	Rho GTPase activating protein 21
17	9544.ENSMMUP00000003593	0.612	Fukutin isoform a
18	9544.ENSMMUP00000002534	0.588	N(alpha)-acetyltransferase 35, NatC auxiliary subunit
19	9544.ENSMMUP00000000736	0.569	Uncharacterized protein
20	9544.ENSMMUP00000000784	0.541	NOP58 ribonucleoprotein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043167	0.534	ion binding
GO:0046872	0.412	metal ion binding
GO:0005509	0.385	calcium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0048856	0.987	anatomical structure development
GO:0050789	0.985	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0051179	0.980	localization
GO:0051641	0.928	cellular localization
GO:0033036	0.927	macromolecule localization
GO:0070727	0.839	cellular macromolecule localization
GO:0032501	0.752	multicellular organismal process
GO:0009653	0.681	anatomical structure morphogenesis
GO:0008104	0.644	protein localization
GO:0048519	0.607	negative regulation of biological process
GO:0009888	0.553	tissue development
GO:0034394	0.539	protein localization to cell surface
GO:0048523	0.512	negative regulation of cellular process
GO:0001738	0.474	morphogenesis of a polarized epithelium
GO:0007164	0.468	establishment of tissue polarity
GO:0007275	0.454	multicellular organism development
GO:0032880	0.445	regulation of protein localization
GO:2000008	0.433	regulation of protein localization to cell surface
GO:0030154	0.371	cell differentiation
GO:0048731	0.363	system development
GO:1903828	0.358	negative regulation of protein localization
GO:0001736	0.327	establishment of planar polarity
GO:0007399	0.317	nervous system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005768	0.998	endosome
GO:0016020	0.993	membrane
GO:0071944	0.818	cell periphery
GO:0005886	0.697	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]