StarFunc result for job id O75132

User Input

>input (1171 residues)
MENNLKTCPKEDGDFVSDKIKFKIEEEDDDGIPPDSLERMDFKSEQEDMKQTDSGGERAG
LGGTGCSCKPPGKYLSAESEDDYGALFSQYSSTLYDVAMEAVTQSLLSSRNMSSRKKSPA
WKHFFISPRDSTKAICMYCVKEFSRGKNEKDLSTSCLMRHVRRAHPTVLIQENGSVSAVS
SFPSPSLLLPPQPADAGDLSTILSPIKLVQKVASKIPSPDRITEESVSVVSSEEISSDMS
VSEKCGREEALVGSSPHLPALHYDEPAENLAEKSLPLPKSTSGSRRRSAVWKHFYLSPLD
NSKAVCIHCMNEFSRGKNGKDLGTSCLIRHMWRAHRAIVLQENGGTGIPPLYSTPPTLLP
SLLPPEGELSSVSSSPVKPVRESPSASSSPDRLTEDLQSHLNPGDGLMEDVAAFSSSDDI
GEASASSPEKQQADGLSPRLFESGAIFQQNKKVMKRLKSEVWHHFSLAPMDSLKAECRYC
GCAISRGKKGDVGTSCLMRHLYRRHPEVVGSQKGFLGASLANSPYATLASAESSSSKLTD
LPTVVTKNNQVMFPVNSKKTSKLWNHFSICSADSTKVVCLHCGRTISRGKKPTNLGTSCL
LRHLQRFHSNVLKTEVSETARPSSPDTRVPRGTELSGASSFDDTNEKFYDSHPVAKKITS
LIAEMIALDLQPYSFVDNVGFNRLLEYLKPQYSLPAPSYFSRTAIPGMYDNVKQIIMSHL
KEAESGVIHFTSGIWMSNQTREYLTLTAHWVSFESPARPRCDDHHCSALLDVSQVDCDYS
GNSIQKQLECWWEAWVTSTGLQVGITVTDNASIGKTLNEGEHSSVQCFSHTVNLIVSEAI
KSQRMVQNLLSLARKICERVHRSPKAKEKLAELQREYALPQHHLIQDVPSKWSTSFHMLE
RLIEQKRAINEMSVECNFRELISCDQWEVMQSVCRALKPFEAASREMSTQMSTLSQVIPM
VHILNRKVEMLFEETMGIDTMLRSLKEAMVSRLSATLHDPRYVFATLLDPRYKASLFTEE
EAEQYKQDLIRELELMNSTSEDVAASHRCDAGSPSKDSAAEENLWSLVAKVKKKDPREKL
PEAMVLAYLEEEVLEHSCDPLTYWNLKKASWPGLSALAVRFLGCPPSIVPSEKLFNTPTE
NGSLGQSRLMMEHFEKLIFLKVNLPLIYFQY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75132	1.000	1.000	0.000	1171	1.000	1.000	O75132.pdb.gz	ZBED4_HUMAN Zinc finger BED domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZBED4 PE=1 SV=2
2	AFDB:Q80WQ9	0.556	0.557	0.000	1168	0.827	0.829	Q80WQ9.pdb.gz	ZBED4_MOUSE Zinc finger BED domain-containing protein 4 OS=Mus musculus OX=10090 GN=Zbed4 PE=2 SV=1
3	AFDB:B8PWL7	0.040	0.045	2.845E-3	994	0.132	0.155	B8PWL7.pdb.gz	B8PWL7_DANRE Disrupted in schizophrenia 1 OS=Danio rerio OX=7955 GN=disc1 PE=2 SV=1
4	AFDB:Q9H2G2	0.040	0.038	2.412E-2	1235	0.096	0.091	Q9H2G2.pdb.gz	SLK_HUMAN STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK PE=1 SV=1
5	AFDB:A8DZ29	0.070	0.052	3.765E-2	1919	0.117	0.071	A8DZ29.pdb.gz	A8DZ29_DROME Eukaryotic translation initiation factor 4G1, isoform B OS=Drosophila melanogaster OX=7227 GN=eIF4G1 PE=1 SV=1
6	AFDB:A2ALU4	0.044	0.040	4.303E-2	1481	0.114	0.090	A2ALU4.pdb.gz	SHRM2_MOUSE Protein Shroom2 OS=Mus musculus OX=10090 GN=Shroom2 PE=1 SV=1
7	AFDB:A0A0R4IZ84	0.062	0.056	7.343E-2	1544	0.118	0.089	A0A0R4IZ84.pdb.gz	EST1A_DANRE Telomerase-binding protein EST1A OS=Danio rerio OX=7955 GN=smg6 PE=2 SV=1
8	PDB:4dchA	0.080	0.175	7.598E-2	434	0.036	0.097	4dchA.pdb.gz	Insights into Mechanism of Glucokinase Activation: OBSERVATION OF MULTIPLE DISTINCT PROTEIN CONFORMATIONS.
9	AFDB:E9PR38	0.075	0.087	1.146E-1	944	0.110	0.137	E9PR38.pdb.gz	E9PR38_HUMAN Pumilio RNA binding family member 1 OS=Homo sapiens OX=9606 GN=PUM1 PE=1 SV=1
10	AFDB:Q96D09	0.059	0.072	1.497E-1	838	0.102	0.142	Q96D09.pdb.gz	GASP2_HUMAN G-protein coupled receptor-associated sorting protein 2 OS=Homo sapiens OX=9606 GN=GPRASP2 PE=1 SV=1
11	PDB:6kr6A	0.060	0.094	1.620E-1	713	0.014	0.022	6kr6A.pdb.gz	Crystal structure of Drosophila Piwi.
12	AFDB:B9ZSJ2	0.055	0.048	1.637E-1	1463	0.122	0.098	B9ZSJ2.pdb.gz	B9ZSJ2_PLAF7 Exported protein family 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0114000 PE=4 SV=1
13	PDB:6oonA	0.058	0.080	2.116E-1	785	0.015	0.023	6oonA.pdb.gz	Multidomain Convergence of Argonaute during RISC Assembly Correlates with the Formation of Internal Water Clusters.
14	PDB:4xo4A	0.056	0.067	2.644E-1	870	0.040	0.054	4xo4A.pdb.gz	Crystal Structure of E. coli Aminopeptidase N in complex with L-Methionine
15	PDB:7t1iB	0.060	0.182	4.314E-1	314	0.011	0.041	7t1iB.pdb.gz	High-resolution crystal structure and chemical screening reveal pantothenate kinase as a new target for antifungal development.
16	PDB:6vrdA	0.051	0.233	4.511E-1	149	0.009	0.067	6vrdA.pdb.gz	Crystal structure of RNase H/RNA/PS-ASO complex at an atomic level
17	PDB:3ngyC	0.062	0.271	6.735E-1	182	0.010	0.066	3ngyC.pdb.gz	Structural basis for RNA trimming by RNase T in stable RNA 3'-end maturation
18	PDB:1vllA	0.038	0.101	7.041E-1	321	0.007	0.025	1vllA.pdb.gz
19	PDB:6dhdA	0.085	0.147	8.048E-1	501	0.046	0.108	6dhdA.pdb.gz	Structures of bovine glutamate dehydrogenase complexes elucidate the mechanism of purine regulation.
20	PDB:7py4A	0.055	0.057	1.005	1112	0.028	0.030	7py4A.pdb.gz	Autoinhibition and regulation by phosphoinositides of ATP8B1, a human lipid flippase associated with intrahepatic cholestatic disorders.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75132	0.0	2425	1171	1.000	1.000	ZBED4_HUMAN Zinc finger BED domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZBED4 PE=1 SV=2
2	Q80WQ9	0.0	1941	1168	0.827	0.830	ZBED4_MOUSE Zinc finger BED domain-containing protein 4 OS=Mus musculus OX=10090 GN=Zbed4 PE=2 SV=1
3	P86452	8.17e-82	291	979	0.208	0.249	ZBED6_HUMAN Zinc finger BED domain-containing protein 6 OS=Homo sapiens OX=9606 GN=ZBED6 PE=1 SV=1
4	D2EAC2	2.87e-81	289	980	0.213	0.255	ZBED6_MOUSE Zinc finger BED domain-containing protein 6 OS=Mus musculus OX=10090 GN=Zbed6 PE=1 SV=1
5	O96006	1.00e-33	142	694	0.137	0.232	ZBED1_HUMAN E3 SUMO-protein ligase ZBED1 OS=Homo sapiens OX=9606 GN=ZBED1 PE=1 SV=1
6	Q6AVI0	1.19e-20	100	722	0.119	0.193	RSLE2_ORYSJ Zinc finger BED domain-containing protein RICESLEEPER 2 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0733400 PE=2 SV=1
7	B9FJG3	4.48e-19	95.5	722	0.113	0.183	RSLE1_ORYSJ Zinc finger BED domain-containing protein RICESLEEPER 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os05g0239150 PE=3 SV=1
8	Q75HY5	3.65e-17	89.4	752	0.109	0.170	RSLE3_ORYSJ Zinc finger BED domain-containing protein RICESLEEPER 3 OS=Oryza sativa subsp. japonica OX=39947 GN=Os05g0583200 PE=2 SV=1
9	Q9M2N5	1.69e-14	80.9	696	0.123	0.207	DSLE_ARATH Zinc finger BED domain-containing protein DAYSLEEPER OS=Arabidopsis thaliana OX=3702 GN=HAT PE=1 SV=1
10	Q0JMB2	4.15e-10	66.6	684	0.084	0.143	RSLE4_ORYSJ Zinc finger BED domain-containing protein RICESLEEPER 4 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0518400 PE=2 SV=3
11	Q19787	3.32e-04	47.4	599	0.029	0.057	BED3_CAEEL Zinc finger BED domain-containing protein 3 OS=Caenorhabditis elegans OX=6239 GN=bed-3 PE=1 SV=1
12	Q9VAF2	0.002	43.9	309	0.037	0.139	Q9VAF2_DROME LD24318p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG15514 PE=1 SV=1
13	Q9BTP6	0.003	42.7	218	0.020	0.106	ZBED2_HUMAN Zinc finger BED domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZBED2 PE=1 SV=2
14	P34418	0.004	43.9	943	0.054	0.067	MIG39_CAEEL Zinc finger BED domain-containing protein 39 OS=Caenorhabditis elegans OX=6239 GN=mig-39 PE=1 SV=3
15	Q25442	0.015	42.0	612	0.087	0.167	Q25442_MUSDO Transposase OS=Musca domestica OX=7370 PE=1 SV=1
16	Q5T7W0	0.024	41.2	954	0.053	0.065	ZN618_HUMAN Zinc finger protein 618 OS=Homo sapiens OX=9606 GN=ZNF618 PE=1 SV=1
17	Q94513	0.027	40.4	282	0.030	0.124	Q94513_DROME Boundary element associated factor OS=Drosophila melanogaster OX=7227 GN=BEAF-32 PE=1 SV=1
18	P53246	0.028	41.2	860	0.036	0.049	ENV11_YEAST Late endosome and vacuole interface protein 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ENV11 PE=1 SV=1
19	Q38BQ0	0.088	39.3	627	0.026	0.048	Q38BQ0_TRYB2 Kinetoplastid-specific dual specificity phosphatase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3960 PE=4 SV=1
20	Q96IU2	0.11	38.1	234	0.021	0.107	ZBED3_HUMAN Zinc finger BED domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZBED3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10000 ACT_3	3.9e+02	12.4	ACT domain
2	PF05699 Dimer_Tnp_hAT	0.00017	32.6	hAT family C-terminal dimerisation region
3	PF02748 PyrI_C	0.22	22.7	Aspartate carbamoyltransferase regulatory chain, metal binding domain
4	PF02892 zf-BED	1.1e-63	222.4	BED zinc finger
5	PF18658 zf-C2H2_12	15	16.7	Spin-doc zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000216268

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000322937	0.708	E3 ubiquitin-protein ligase LRSAM1
2	9606.ENSP00000321370	0.640	Zinc finger BED-type containing 2
3	9606.ENSP00000336724	0.614	TBC1 domain family member 22A
4	9606.ENSP00000324403	0.552	PHD finger protein 21B
5	9606.ENSP00000346120	0.546	Nucleolar RNA helicase 2
6	9606.ENSP00000376872	0.530	Rab-like protein 2A
7	9606.ENSP00000263245	0.519	ADP-ribosylation factor GTPase-activating protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.999	identical protein binding
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.995	transcription cis-regulatory region binding
GO:0000977	0.850	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001216	0.750	DNA-binding transcription activator activity
GO:0001228	0.326	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0006355	0.979	regulation of DNA-templated transcription
GO:0048522	0.977	positive regulation of cellular process
GO:0006357	0.974	regulation of transcription by RNA polymerase II
GO:0045893	0.966	positive regulation of DNA-templated transcription
GO:0045944	0.840	positive regulation of transcription by RNA polymerase II
GO:0009987	0.610	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0005654	0.994	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]