StarFunc result for job id O75140

User Input

>input (1603 residues)
MRTTKVYKLVIHKKGFGGSDDELVVNPKVFPHIKLGDIVEIAHPNDEYSPLLLQVKSLKE
DLQKETISVDQTVTQVFRLRPYQDVYVNVVDPKDVTLDLVELTFKDQYIGRGDMWRLKKS
LVSTCAYITQKVEFAGIRAQAGELWVKNEKVMCGYISEDTRVVFRSTSAMVYIFIQMSCE
MWDFDIYGDLYFEKAVNGFLADLFTKWKEKNCSHEVTVVLFSRTFYDAKSVDEFPEINRA
SIRQDHKGRFYEDFYKVVVQNERREEWTSLLVTIKKLFIQYPVLVRLEQAEGFPQGDNST
SAQGNYLEAINLSFNVFDKHYINRNFDRTGQMSVVITPGVGVFEVDRLLMILTKQRMIDN
GIGVDLVCMGEQPLHAVPLFKLHNRSAPRDSRLGDDYNIPHWINHSFYTSKSQLFCNSFT
PRIKLAGKKPASEKAKNGRDTSLGSPKESENALPIQVDYDAYDAQVFRLPGPSRAQCLTT
CRSVRERESHSRKSASSCDVSSSPSLPSRTLPTEEVRSQASDDSSLGKSANILMIPHPHL
HQYEVSSSLGYTSTRDVLENMMEPPQRDSSAPGRFHVGSAESMLHVRPGGYTPQRALINP
FAPSRMPMKLTSNRRRWMHTFPVGPSGEAIQIHHQTRQNMAELQGSGQRDPTHSSAELLE
LAYHEAAGRHSNSRQPGDGMSFLNFSGTEELSVGLLSNSGAGMNPRTQNKDSLEDSVSTS
PDPILTLSAPPVVPGFCCTVGVDWKSLTTPACLPLTTDYFPDRQGLQNDYTEGCYDLLPE
ADIDRRDEDGVQMTAQQVFEEFICQRLMQGYQIIVQPKTQKPNPAVPPPLSSSPLYSRGL
VSRNRPEEEDQYWLSMGRTFHKVTLKDKMITVTRYLPKYPYESAQIHYTYSLCPSHSDSE
FVSCWVEFSHERLEEYKWNYLDQYICSAGSEDFSLIESLKFWRTRFLLLPACVTATKRIT
EGEAHCDIYGDRPRADEDEWQLLDGFVRFVEGLNRIRRRHRSDRMMRKGTAMKGLQMTGP
ISTHSLESTAPPVGKKGTSALSALLEMEASQKCLGEQQAAVHGGKSSAQSAESSSVAMTP
TYMDSPRKDGAFFMEFVRSPRTASSAFYPQVSVDQTATPMLDGTSLGICTGQSMDRGNSQ
TFGNSQNIGEQGYSSTNSSDSSSQQLVASSLTSSSTLTEILEAMKHPSTGVQLLSEQKGL
SPYCFISAEVVHWLVNHVEGIQTQAMAIDIMQKMLEEQLITHASGEAWRTFIYGFYFYKI
VTDKEPDRVAMQQPATTWHTAGVDDFASFQRKWFEVAFVAEELVHSEIPAFLLPWLPSRP
ASYASRHSSFSRSFGGRSQAAALLAATVPEQRTVTLDVDVNNRTDRLEWCSCYYHGNFSL
NAAFEIKLHWMAVTAAVLFEMVQGWHRKATSCGFLLVPVLEGPFALPSYLYGDPLRAQLF
IPLNISCLLKEGSEHLFDSFEPETYWDRMHLFQEAIAHRFGFVQDKYSASAFNFPAENKP
QYIHVTGTVFLQLPYSKRKFSGQQRRRRNSTSSTNQNMFCEERVGYNWAYNTMLTKTWRS
SATGDEKFADRLLKDFTDFCINRDNRLVTFWTSCLEKMHASAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7t3aA	0.602	0.969	0.000	990	0.613	0.992	7t3aA.pdb.gz	Cryo-EM structures of the human GATOR1-Rag-Ragulator complex reveal a spatial-constraint regulated GAP mechanism.
2	AFDB:E7EXM8	0.838	0.838	0.000	1603	0.759	0.759	E7EXM8.pdb.gz	E7EXM8_DANRE DEP domain-containing 5, GATOR1 subcomplex subunit OS=Danio rerio OX=7955 GN=depdc5 PE=1 SV=2
3	AFDB:O75140	1.000	1.000	0.000	1603	1.000	1.000	O75140.pdb.gz	DEPD5_HUMAN GATOR1 complex protein DEPDC5 OS=Homo sapiens OX=9606 GN=DEPDC5 PE=1 SV=2
4	PDB:6cesD	0.425	0.726	1.862E-80	901	0.540	0.961	6cesD.pdb.gz	Architecture of the human GATOR1 and GATOR1-Rag GTPases complexes.
5	AFDB:P47170	0.483	0.488	2.644E-72	1584	0.180	0.182	P47170.pdb.gz	IML1_YEAST Vacuolar membrane-associated protein IML1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IML1 PE=1 SV=1
6	PDB:3j96A	0.091	0.199	1.002E-7	678	0.014	0.034	3j96A.pdb.gz
7	PDB:3j96F	0.103	0.224	2.445E-7	654	0.027	0.066	3j96F.pdb.gz
8	PDB:6mdmD	0.088	0.187	7.358E-7	713	0.011	0.025	6mdmD.pdb.gz	Structural principles of SNARE complex recognition by the AAA+ protein NSF.
9	PDB:6opcF	0.083	0.184	1.069E-5	681	0.017	0.041	6opcF.pdb.gz	Structure of the Cdc48 segregase in the act of unfolding an authentic substrate.
10	PDB:6opcB	0.084	0.173	2.227E-5	741	0.012	0.026	6opcB.pdb.gz	Structure of the Cdc48 segregase in the act of unfolding an authentic substrate.
11	PDB:7ln6F	0.078	0.165	2.607E-5	714	0.019	0.042	7ln6F.pdb.gz	Mechanistic insight into substrate processing and allosteric inhibition of human p97.
12	PDB:7vcsA	0.084	0.166	1.258E-4	766	0.021	0.043	7vcsA.pdb.gz	Cryo-EM structures of human p97 double hexamer capture potentiated ATPase-competent state.
13	PDB:5ifwB	0.082	0.178	1.552E-4	702	0.013	0.030	5ifwB.pdb.gz	Quantitative interaction mapping reveals an extended UBX domain in ASPL that disrupts functional p97 hexamers.
14	AFDB:B1Q240	0.058	0.098	3.216E-3	915	0.085	0.149	B1Q240.pdb.gz	B1Q240_CAEEL DiSHevelled related OS=Caenorhabditis elegans OX=6239 GN=dsh-1 PE=1 SV=2
15	AFDB:Q2UY11	0.077	0.105	1.817E-2	1141	0.073	0.103	Q2UY11.pdb.gz	COSA1_MOUSE Collagen alpha-1(XXVIII) chain OS=Mus musculus OX=10090 GN=Col28a1 PE=2 SV=1
16	AFDB:P53882	0.037	0.071	1.915E-2	636	0.067	0.168	P53882.pdb.gz	TDA7_YEAST Topoisomerase I damage affected protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TDA7 PE=1 SV=2
17	AFDB:Q04980	0.025	0.051	1.926E-1	619	0.065	0.168	Q04980.pdb.gz	LTI65_ARATH Low-temperature-induced 65 kDa protein OS=Arabidopsis thaliana OX=3702 GN=LTI65 PE=2 SV=2
18	AFDB:Q8IS12	0.040	0.052	2.030E-1	1138	0.076	0.107	Q8IS12.pdb.gz	GEFN_DICDI Ras guanine nucleotide exchange factor N OS=Dictyostelium discoideum OX=44689 GN=gefN PE=2 SV=1
19	AFDB:Q8MT36	0.025	0.028	5.218E-1	1427	0.054	0.061	Q8MT36.pdb.gz	NSD_DROME Nuclear receptor binding SET domain protein OS=Drosophila melanogaster OX=7227 GN=NSD PE=1 SV=2
20	AFDB:Q9Y2W1	0.029	0.044	5.218E-1	955	0.072	0.120	Q9Y2W1.pdb.gz	TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7EXM8	0.0	2415	1603	0.761	0.761	E7EXM8_DANRE DEP domain-containing 5, GATOR1 subcomplex subunit OS=Danio rerio OX=7955 GN=depdc5 PE=1 SV=2
2	M9PDV3	0.0	714	1503	0.268	0.285	M9PDV3_DROME Increased minichromosome loss 1, isoform E OS=Drosophila melanogaster OX=7227 GN=Iml1 PE=1 SV=1
3	M9PE64	0.0	702	1511	0.268	0.285	M9PE64_DROME Increased minichromosome loss 1, isoform D OS=Drosophila melanogaster OX=7227 GN=Iml1 PE=1 SV=1
4	O75140	0.0	3364	1603	1.000	1.000	DEPD5_HUMAN GATOR1 complex protein DEPDC5 OS=Homo sapiens OX=9606 GN=DEPDC5 PE=1 SV=2
5	P61460	0.0	3051	1591	0.942	0.949	DEPD5_MOUSE GATOR1 complex protein DEPDC5 OS=Mus musculus OX=10090 GN=Depdc5 PE=1 SV=2
6	Q8IRG8	0.0	711	1472	0.265	0.288	Q8IRG8_DROME Increased minichromosome loss 1, isoform C OS=Drosophila melanogaster OX=7227 GN=Iml1 PE=1 SV=1
7	Q9W0E3	0.0	703	1544	0.271	0.281	IML1_DROME GATOR complex protein Iml1 OS=Drosophila melanogaster OX=7227 GN=Iml1 PE=1 SV=2
8	O74788	1.80e-56	219	1496	0.081	0.087	IML1_SCHPO Vacuolar membrane-associated protein iml1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=iml1 PE=1 SV=1
9	P47170	7.80e-45	181	1584	0.074	0.074	IML1_YEAST Vacuolar membrane-associated protein IML1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IML1 PE=1 SV=1
10	P51140	0.008	43.1	623	0.014	0.037	DSH_DROME Segment polarity protein dishevelled OS=Drosophila melanogaster OX=7227 GN=dsh PE=1 SV=2
11	P51142	0.016	42.4	736	0.014	0.030	DVL2_XENLA Segment polarity protein dishevelled homolog DVL-2 OS=Xenopus laevis OX=8355 GN=dvl2 PE=1 SV=1
12	B1Q240	0.031	41.6	915	0.013	0.023	B1Q240_CAEEL DiSHevelled related OS=Caenorhabditis elegans OX=6239 GN=dsh-1 PE=1 SV=2
13	Q18239	0.032	41.6	759	0.016	0.033	Q18239_CAEEL DiSHevelled related OS=Caenorhabditis elegans OX=6239 GN=dsh-2 PE=1 SV=5
14	Q9WVB9	0.040	41.2	695	0.015	0.035	DVL1_RAT Segment polarity protein dishevelled homolog DVL-1 OS=Rattus norvegicus OX=10116 GN=Dvl1 PE=1 SV=3
15	P51141	0.041	40.8	695	0.015	0.035	DVL1_MOUSE Segment polarity protein dishevelled homolog DVL-1 OS=Mus musculus OX=10090 GN=Dvl1 PE=1 SV=2
16	H2KZ17	0.052	40.8	702	0.013	0.030	H2KZ17_CAEEL DiSHevelled related OS=Caenorhabditis elegans OX=6239 GN=dsh-1 PE=1 SV=1
17	B7WN58	0.060	40.4	636	0.013	0.033	B7WN58_CAEEL DiSHevelled related OS=Caenorhabditis elegans OX=6239 GN=dsh-1 PE=1 SV=1
18	I3L2N2	0.075	40.0	730	0.016	0.034	I3L2N2_HUMAN Dishevelled segment polarity protein 2 OS=Homo sapiens OX=9606 GN=DVL2 PE=1 SV=1
19	O14641	0.077	40.0	736	0.016	0.034	DVL2_HUMAN Segment polarity protein dishevelled homolog DVL-2 OS=Homo sapiens OX=9606 GN=DVL2 PE=1 SV=1
20	D4ADV8	0.091	40.0	718	0.014	0.031	D4ADV8_RAT Dishevelled segment polarity protein 3 OS=Rattus norvegicus OX=10116 GN=Dvl3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00610 DEP	5.1e-07	41.0	Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)
2	PF19418 DEPDC5_CTD	8e-183	618.4	DEPDC5 protein C-terminal region
3	PF00370 FGGY_N	2.2e+02	12.8	FGGY family of carbohydrate kinases, N-terminal domain
4	PF12257 IML1	1.5e-109	377.1	Vacuolar membrane-associated protein Iml1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000383105

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000232501	0.999	GATOR complex protein NPRL2
2	9606.ENSP00000369899	0.999	Ras-related GTP-binding protein A
3	9606.ENSP00000483814	0.999	GATOR complex protein NPRL3
4	9606.ENSP00000262144	0.998	GATOR complex protein WDR59
5	9606.ENSP00000339881	0.998	GATOR complex protein MIOS
6	9606.ENSP00000293883	0.997	GATOR complex protein WDR24
7	9606.ENSP00000362092	0.997	Ras-related GTP-binding protein C
8	9606.ENSP00000382779	0.996	Nucleoporin SEH1
9	9606.ENSP00000373312	0.994	Protein SEC13 homolog
10	9606.ENSP00000262850	0.988	Ras-related GTP-binding protein B
11	9606.ENSP00000457168	0.980	KICSTOR complex protein SZT2
12	9606.ENSP00000228799	0.978	KICSTOR complex protein ITFG2
13	9606.ENSP00000311486	0.972	KICSTOR complex protein C12orf66
14	9606.ENSP00000358423	0.972	Ras-related GTP-binding protein D
15	9606.ENSP00000262187	0.966	GTP-binding protein Rheb
16	9606.ENSP00000354558	0.962	Serine/threonine-protein kinase mTOR
17	9606.ENSP00000337850	0.961	KICSTOR complex protein kaptin
18	9606.ENSP00000307272	0.951	Regulatory-associated protein of mTOR
19	9606.ENSP00000343118	0.950	Ragulator complex protein LAMTOR4
20	9606.ENSP00000278671	0.948	Ragulator complex protein LAMTOR1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0005515	1.000	protein binding
GO:0005096	1.000	GTPase activator activity
GO:0003824	0.309	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:1902531	0.985	regulation of intracellular signal transduction
GO:0050896	0.983	response to stimulus
GO:0009987	0.983	cellular process
GO:0032006	0.983	regulation of TOR signaling
GO:1990928	0.973	response to amino acid starvation
GO:0051716	0.960	cellular response to stimulus
GO:1903432	0.956	regulation of TORC1 signaling
GO:1902532	0.955	negative regulation of intracellular signal transduction
GO:0032007	0.950	negative regulation of TOR signaling
GO:0071496	0.947	cellular response to external stimulus
GO:0034198	0.937	cellular response to amino acid starvation
GO:0032501	0.864	multicellular organismal process
GO:1904262	0.843	negative regulation of TORC1 signaling
GO:0065008	0.757	regulation of biological quality
GO:0042391	0.586	regulation of membrane potential
GO:0007626	0.568	locomotory behavior
GO:0098900	0.525	regulation of action potential
GO:0031644	0.524	regulation of nervous system process
GO:0036269	0.510	swimming behavior

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0032991	0.997	protein-containing complex
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0016020	0.993	membrane
GO:0005829	0.993	cytosol
GO:0005765	0.977	lysosomal membrane
GO:0035859	0.860	Seh1-associated complex
GO:0140535	0.709	intracellular protein-containing complex
GO:1902494	0.704	catalytic complex
GO:1990234	0.529	transferase complex
GO:1990130	0.476	GATOR1 complex
GO:0005634	0.471	nucleus
GO:0070013	0.430	intracellular organelle lumen
GO:0071944	0.353	cell periphery
GO:0000151	0.353	ubiquitin ligase complex
GO:0031981	0.353	nuclear lumen
GO:0031982	0.340	vesicle
GO:0012505	0.332	endomembrane system
GO:0005886	0.330	plasma membrane
GO:0005654	0.326	nucleoplasm
GO:0031463	0.324	Cul3-RING ubiquitin ligase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]