StarFunc result for job id O75143

User Input

>input (517 residues)
METDLNSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPE
VTHEAKKALAGQLPAVGRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNR
LSLLLKSLLAITRVTPAYRLSRKQGHEYVILYRIYFGEVQLSGLGEGFQTVRVGTVGTPV
GTITLSCAYRINLAFMSTRQFERTPPIMGIIIDHFVDRPYPSSSPMHPCNYRTAGEDTGV
IYPSVEDSQEVCTTSFSTSPPSQLSSSRLSYQPAALGVGSADLAYPVVFAAGLNATHPHQ
LMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRA
SPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETE
SPLQGSLHSDGSSGGSSGNTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLS
IDIGAQSMAEDLDSLPEKLAVHEKNVREFDAFVETLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75143	0.999	0.999	1.578E-82	517	1.000	1.000	O75143.pdb.gz	ATG13_HUMAN Autophagy-related protein 13 OS=Homo sapiens OX=9606 GN=ATG13 PE=1 SV=1
2	PDB:3abdA	0.242	0.607	3.174E-6	180	0.044	0.128	3abdA.pdb.gz	Crystal structure of human REV7 in complex with a human REV3 fragment and structural implication of the interaction between DNA polymerase {zeta} and REV1
3	PDB:4aezH	0.240	0.572	6.339E-6	185	0.054	0.151	4aezH.pdb.gz
4	PDB:2v64A	0.208	0.438	1.128E-5	210	0.058	0.143	2v64A.pdb.gz	The MAD2 Conformational Dimer: Structure and Implications for the Spindle Assembly Checkpoint
5	PDB:6keaD	0.197	0.178	3.007E-5	584	0.050	0.045	6keaD.pdb.gz
6	PDB:4trkA	0.165	0.315	9.023E-4	242	0.039	0.083	4trkA.pdb.gz
7	PDB:7lxdE	0.200	0.408	1.431E-3	205	0.064	0.161	7lxdE.pdb.gz	Cryo-EM reveals conformational flexibility in apo DNA polymerase zeta.
8	PDB:6bi7G	0.197	0.550	5.709E-3	154	0.037	0.123	6bi7G.pdb.gz	Rev7 dimerization is important for assembly and function of the Rev1/Pol zeta translesion synthesis complex.
9	PDB:3hzhB	0.114	0.270	1.280E-2	154	0.033	0.110	3hzhB.pdb.gz	Identical phosphatase mechanisms achieved through distinct modes of binding phosphoprotein substrate.
10	AFDB:Q383W7	0.070	0.049	2.637E-2	764	0.124	0.084	Q383W7.pdb.gz	Q383W7_TRYB2 Leucine-rich repeat protein (LRRP) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1380 PE=4 SV=1
11	AFDB:F4IDB2	0.114	0.055	3.135E-2	1325	0.147	0.057	F4IDB2.pdb.gz	PHL_ARATH Protein PHYTOCHROME-DEPENDENT LATE-FLOWERING OS=Arabidopsis thaliana OX=3702 GN=PHL PE=1 SV=1
12	AFDB:Q8NEM7	0.079	0.060	5.267E-2	779	0.132	0.087	Q8NEM7.pdb.gz	SP20H_HUMAN Transcription factor SPT20 homolog OS=Homo sapiens OX=9606 GN=SUPT20H PE=1 SV=2
13	PDB:3bg5B	0.060	0.036	1.441E-1	1074	0.031	0.015	3bg5B.pdb.gz	Crystal structures of human and Staphylococcus aureus pyruvate carboxylase and molecular insights into the carboxyltransfer reaction.
14	PDB:5iv5BE	0.080	0.179	1.441E-1	165	0.023	0.073	5iv5BE.pdb.gz	Structure of the T4 baseplate and its function in triggering sheath contraction.
15	AFDB:X5M5N0	0.079	0.034	2.803E-1	1850	0.130	0.036	X5M5N0.pdb.gz	WNK_CAEEL Serine/threonine-protein kinase WNK OS=Caenorhabditis elegans OX=6239 GN=wnk-1 PE=1 SV=1
16	AFDB:W5UIG7	0.059	0.034	2.970E-1	1118	0.110	0.051	W5UIG7.pdb.gz	W5UIG7_ICTPU phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase OS=Ictalurus punctatus OX=7998 GN=Inpp5d PE=2 SV=1
17	AFDB:A2VEG3	0.069	0.050	3.146E-1	851	0.153	0.093	A2VEG3.pdb.gz	A2VEG3_DROME IP16294p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8671 PE=2 SV=1
18	AFDB:D4A3Q3	0.075	0.036	3.740E-1	1417	0.118	0.043	D4A3Q3.pdb.gz	D4A3Q3_RAT Nuclear receptor coactivator OS=Rattus norvegicus OX=10116 GN=Ncoa1 PE=1 SV=2
19	AFDB:Q06216	0.058	0.049	4.197E-1	648	0.120	0.096	Q06216.pdb.gz	PIG1_YEAST Serine/threonine-protein phosphatase 1 regulatory subunit PIG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PIG1 PE=1 SV=1
20	AFDB:Q38BV9	0.071	0.053	4.197E-1	780	0.099	0.065	Q38BV9.pdb.gz	Q38BV9_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4780 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75143	0.0	1071	517	1.000	1.000	ATG13_HUMAN Autophagy-related protein 13 OS=Homo sapiens OX=9606 GN=ATG13 PE=1 SV=1
2	Q91YI1	0.0	950	516	0.936	0.938	ATG13_MOUSE Autophagy-related protein 13 OS=Mus musculus OX=10090 GN=Atg13 PE=1 SV=2
3	Q9VHR6	8.12e-50	181	523	0.191	0.189	ATG13_DROME Autophagy-related protein 13 homolog OS=Drosophila melanogaster OX=7227 GN=Atg13 PE=1 SV=1
4	P34379	3.85e-23	104	443	0.116	0.135	ATG13_CAEEL Autophagy-related protein 13 homolog OS=Caenorhabditis elegans OX=6239 GN=atg-13 PE=1 SV=1
5	Q9SCK0	5.21e-05	48.1	603	0.153	0.131	AT13A_ARATH Autophagy-related protein 13a OS=Arabidopsis thaliana OX=3702 GN=ATG13A PE=1 SV=1
6	Q2ULT1	0.42	35.8	974	0.054	0.029	ATG13_ASPOR Autophagy-related protein 13 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=atg13 PE=3 SV=1
7	O14148	6.1	32.3	1604	0.033	0.011	INO80_SCHPO Chromatin-remodeling ATPase INO80 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ino80 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10033 ATG13	9.8e-11	53.3	Autophagy-related protein 13

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000003811

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000005179	0.999	Autophagy related 101
2	9601.ENSPPYP00000020840	0.997	RB1-inducible coiled-coil 1
3	9601.ENSPPYP00000009920	0.995	Unc-51 like autophagy activating kinase 2
4	9601.ENSPPYP00000005848	0.994	Unc-51 like autophagy activating kinase 1
5	9601.ENSPPYP00000006635	0.981	Autophagy related 14
6	9601.ENSPPYP00000021460	0.981	Chromosome 9 open reading frame 72
7	9601.ENSPPYP00000024617	0.969	Regulatory associated protein of MTOR, complex 1
8	9601.ENSPPYP00000007913	0.963	MTOR associated protein, LST8 homolog (S. cerevisiae)
9	9601.ENSPPYP00000010247	0.958	Phosphatidylinositol 3-kinase, catalytic subunit type 3
10	9601.ENSPPYP00000015770	0.948	Regulatory subunit of the PI3K complex that mediates formation of phosphatidylinositol 3-phosphate
11	9601.ENSPPYP00000014748	0.940	Involved in autophagy and cytoplasm to vacuole transport (Cvt) vesicle formation. Plays a key role in the organization of the preautophagosomal structure/phagophore assembly site (PAS), the nucleating site for formation of the sequestering vesicle. Cycles between a juxta-nuclear trans-Golgi network compartment and late endosomes. Nutrient starvation induces accumulation on autophagosomes. Starvation-dependent trafficking requires ULK1, ATG13 and SUPT20H (By similarity)
12	9601.ENSPPYP00000009414	0.934	Plays a central role in autophagy. Acts as core subunit of the PI3K complex that mediates formation of phosphatidylinositol 3- phosphate
13	9601.ENSPPYP00000008889	0.916	GABA(A) receptor-associated protein
14	9601.ENSPPYP00000000063	0.905	Beclin 2
15	9601.ENSPPYP00000020385	0.901	Autophagy-related protein 9
16	9601.ENSPPYP00000021144	0.880	DEP domain containing MTOR-interacting protein
17	9601.ENSPPYP00000007541	0.879	Unc-51 like kinase 3
18	9601.ENSPPYP00000009889	0.870	Vacuole membrane protein 1
19	9601.ENSPPYP00000003814	0.868	Autophagy/beclin-1 regulator 1
20	9601.ENSPPYP00000012214	0.863	Microtubule-associated protein 1 light chain 3 alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	0.998	enzyme binding
GO:0019901	0.993	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0008152	0.996	metabolic process
GO:0050794	0.996	regulation of cellular process
GO:0044237	0.994	cellular metabolic process
GO:0071704	0.981	organic substance metabolic process
GO:0048518	0.979	positive regulation of biological process
GO:0044238	0.978	primary metabolic process
GO:0019222	0.976	regulation of metabolic process
GO:0006807	0.975	nitrogen compound metabolic process
GO:0016310	0.969	phosphorylation
GO:0036211	0.966	protein modification process
GO:0000045	0.966	autophagosome assembly
GO:0048522	0.965	positive regulation of cellular process
GO:0060255	0.962	regulation of macromolecule metabolic process
GO:0006468	0.960	protein phosphorylation
GO:0031323	0.959	regulation of cellular metabolic process
GO:0048523	0.957	negative regulation of cellular process
GO:0051246	0.954	regulation of protein metabolic process
GO:0046777	0.951	protein autophosphorylation
GO:0010556	0.935	regulation of macromolecule biosynthetic process
GO:0031326	0.933	regulation of cellular biosynthetic process
GO:0031399	0.925	regulation of protein modification process
GO:2000112	0.902	regulation of cellular macromolecule biosynthetic process
GO:0050896	0.888	response to stimulus
GO:0042127	0.837	regulation of cell population proliferation
GO:0051716	0.804	cellular response to stimulus
GO:0008285	0.743	negative regulation of cell population proliferation
GO:0010506	0.678	regulation of autophagy
GO:0009893	0.662	positive regulation of metabolic process
GO:0031325	0.545	positive regulation of cellular metabolic process
GO:0006950	0.538	response to stress
GO:0022411	0.395	cellular component disassembly
GO:0032879	0.355	regulation of localization
GO:0033554	0.338	cellular response to stress
GO:0009896	0.336	positive regulation of catabolic process
GO:0051049	0.329	regulation of transport
GO:0060341	0.328	regulation of cellular localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:1990316	0.999	Atg1/ULK1 kinase complex
GO:0000407	0.997	phagophore assembly site
GO:0043231	0.981	intracellular membrane-bounded organelle
GO:0016020	0.973	membrane
GO:0012505	0.894	endomembrane system
GO:0031090	0.824	organelle membrane
GO:0005783	0.665	endoplasmic reticulum
GO:0031984	0.661	organelle subcompartment
GO:0098827	0.642	endoplasmic reticulum subcompartment
GO:0042175	0.640	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.569	endoplasmic reticulum membrane
GO:0005739	0.556	mitochondrion
GO:0005634	0.504	nucleus
GO:0031981	0.432	nuclear lumen
GO:0043232	0.301	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]