StarFunc result for job id O75144

User Input

>input (302 residues)
MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESK
TVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSL
GFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLL
DQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERD
KITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTG
HV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:K4DIA0	0.750	0.491	3.151E-52	473	0.993	0.634	K4DIA0.pdb.gz	K4DIA0_HUMAN Inducible T cell costimulator ligand OS=Homo sapiens OX=9606 GN=ICOSLG PE=1 SV=1
2	AFDB:Q9JHJ8	0.682	0.641	3.616E-29	322	0.444	0.416	Q9JHJ8.pdb.gz	ICOSL_MOUSE ICOS ligand OS=Mus musculus OX=10090 GN=Icoslg PE=1 SV=1
3	AFDB:Q8VE98	0.595	0.570	1.540E-19	316	0.285	0.272	Q8VE98.pdb.gz	CD276_MOUSE CD276 antigen OS=Mus musculus OX=10090 GN=Cd276 PE=1 SV=1
4	AFDB:Q5ZPR3	0.583	0.338	2.701E-18	534	0.272	0.154	Q5ZPR3.pdb.gz	CD276_HUMAN CD276 antigen OS=Homo sapiens OX=9606 GN=CD276 PE=1 SV=1
5	AFDB:P42082	0.588	0.576	4.129E-18	309	0.199	0.194	P42082.pdb.gz	CD86_MOUSE T-lymphocyte activation antigen CD86 OS=Mus musculus OX=10090 GN=Cd86 PE=1 SV=1
6	AFDB:D4AE25	0.570	0.592	9.647E-18	290	0.205	0.214	D4AE25.pdb.gz	D4AE25_RAT CD274 molecule OS=Rattus norvegicus OX=10116 GN=Cd274 PE=4 SV=2
7	AFDB:Q9EP73	0.550	0.571	1.729E-17	290	0.195	0.203	Q9EP73.pdb.gz	PD1L1_MOUSE Programmed cell death 1 ligand 1 OS=Mus musculus OX=10090 GN=Cd274 PE=1 SV=1
8	AFDB:O35531	0.575	0.557	4.995E-17	313	0.202	0.195	O35531.pdb.gz	O35531_RAT CD86 molecule OS=Rattus norvegicus OX=10116 GN=Cd86 PE=1 SV=1
9	AFDB:P42081	0.587	0.544	1.522E-16	329	0.205	0.188	P42081.pdb.gz	CD86_HUMAN T-lymphocyte activation antigen CD86 OS=Homo sapiens OX=9606 GN=CD86 PE=1 SV=2
10	AFDB:G3V671	0.558	0.528	2.206E-16	321	0.238	0.224	G3V671.pdb.gz	G3V671_RAT Cd80 molecule OS=Rattus norvegicus OX=10116 GN=Cd80 PE=4 SV=2
11	PDB:5c7kF	0.296	0.390	1.597E-10	212	0.152	0.217	5c7kF.pdb.gz	Complete epitopes for vaccine design derived from a crystal structure of the broadly neutralizing antibodies PGT128 and 8ANC195 in complex with an HIV-1 Env trimer.
12	PDB:3o3uN	0.513	0.284	3.184E-10	580	0.142	0.074	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
13	PDB:3u0wL	0.269	0.368	8.722E-10	213	0.159	0.225	3u0wL.pdb.gz
14	PDB:3c2aL	0.296	0.397	9.698E-10	216	0.149	0.208	3c2aL.pdb.gz	Structure determination of an anti-HIV-1 Fab 447-52D-peptide complex from an epitaxially twinned data set
15	PDB:4adfM	0.533	0.807	1.199E-9	191	0.126	0.199	4adfM.pdb.gz
16	PDB:1gafL	0.282	0.367	1.482E-9	214	0.142	0.201	1gafL.pdb.gz	The immunological evolution of catalysis.
17	PDB:4d9rL	0.309	0.400	1.648E-9	214	0.152	0.215	4d9rL.pdb.gz
18	PDB:1kc5L	0.282	0.355	1.833E-9	214	0.149	0.210	1kc5L.pdb.gz	Epitope recognition by diverse antibodies suggests conformational convergence in an antibody response.
19	PDB:6dcvA	0.320	0.400	2.038E-9	220	0.136	0.186	6dcvA.pdb.gz
20	PDB:4lluB	0.302	0.402	2.266E-9	210	0.132	0.190	4lluB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0N0L8	0.0	624	302	1.000	1.000	A0N0L8_HUMAN Inducible T-cell co-stimulator ligand OS=Homo sapiens OX=9606 GN=ICOSLG PE=2 SV=1
2	K4DIA0	0.0	616	473	0.993	0.634	K4DIA0_HUMAN Inducible T cell costimulator ligand OS=Homo sapiens OX=9606 GN=ICOSLG PE=1 SV=1
3	O75144	0.0	624	302	1.000	1.000	ICOSL_HUMAN ICOS ligand OS=Homo sapiens OX=9606 GN=ICOSLG PE=1 SV=2
4	Q9JHJ8	2.04e-66	212	322	0.394	0.370	ICOSL_MOUSE ICOS ligand OS=Mus musculus OX=10090 GN=Icoslg PE=1 SV=1
5	Q5ZPR3	4.45e-22	98.2	534	0.268	0.152	CD276_HUMAN CD276 antigen OS=Homo sapiens OX=9606 GN=CD276 PE=1 SV=1
6	Q8VE98	4.04e-20	90.5	316	0.228	0.218	CD276_MOUSE CD276 antigen OS=Mus musculus OX=10090 GN=Cd276 PE=1 SV=1
7	Q62556	3.78e-15	77.8	524	0.209	0.120	BT1A1_MOUSE Butyrophilin subfamily 1 member A1 OS=Mus musculus OX=10090 GN=Btn1a1 PE=1 SV=2
8	D4AE25	3.10e-12	67.8	290	0.202	0.210	D4AE25_RAT CD274 molecule OS=Rattus norvegicus OX=10116 GN=Cd274 PE=4 SV=2
9	Q13410	3.36e-11	65.9	526	0.185	0.106	BT1A1_HUMAN Butyrophilin subfamily 1 member A1 OS=Homo sapiens OX=9606 GN=BTN1A1 PE=1 SV=3
10	O35531	1.15e-10	63.5	313	0.202	0.195	O35531_RAT CD86 molecule OS=Rattus norvegicus OX=10116 GN=Cd86 PE=1 SV=1
11	P42082	9.50e-10	60.8	309	0.156	0.152	CD86_MOUSE T-lymphocyte activation antigen CD86 OS=Mus musculus OX=10090 GN=Cd86 PE=1 SV=1
12	P33681	3.20e-09	58.9	288	0.166	0.174	CD80_HUMAN T-lymphocyte activation antigen CD80 OS=Homo sapiens OX=9606 GN=CD80 PE=1 SV=1
13	Q9UIR0	3.90e-09	59.3	455	0.152	0.101	BTNL2_HUMAN Butyrophilin-like protein 2 OS=Homo sapiens OX=9606 GN=BTNL2 PE=1 SV=1
14	Q9EP73	1.38e-08	57.0	290	0.192	0.200	PD1L1_MOUSE Programmed cell death 1 ligand 1 OS=Mus musculus OX=10090 GN=Cd274 PE=1 SV=1
15	Q6UX41	1.68e-08	57.8	500	0.205	0.124	BTNL8_HUMAN Butyrophilin-like protein 8 OS=Homo sapiens OX=9606 GN=BTNL8 PE=1 SV=1
16	A0A8J8XMF6	1.81e-08	57.0	297	0.185	0.189	A0A8J8XMF6_RAT CD86 molecule OS=Rattus norvegicus OX=10116 GN=Cd86 PE=1 SV=1
17	Q9NZQ7	4.04e-08	55.8	290	0.159	0.166	PD1L1_HUMAN Programmed cell death 1 ligand 1 OS=Homo sapiens OX=9606 GN=CD274 PE=1 SV=1
18	H7C4F8	4.18e-08	55.5	277	0.202	0.220	H7C4F8_HUMAN CD86 molecule (Fragment) OS=Homo sapiens OX=9606 GN=CD86 PE=1 SV=1
19	P78410	7.81e-08	55.1	334	0.172	0.156	BT3A2_HUMAN Butyrophilin subfamily 3 member A2 OS=Homo sapiens OX=9606 GN=BTN3A2 PE=1 SV=2
20	Q9BQ51	8.79e-08	54.7	273	0.209	0.231	PD1L2_HUMAN Programmed cell death 1 ligand 2 OS=Homo sapiens OX=9606 GN=PDCD1LG2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	0.12	23.7	CD80-like C2-set immunoglobulin domain
2	PF07679 I-set	0.032	25.6	Immunoglobulin I-set domain
3	PF00047 ig	0.26	22.8	Immunoglobulin domain
4	PF13927 Ig_3	7.5e-05	34.5	Immunoglobulin domain
5	PF07686 V-set	3e-05	35.5	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000483732

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000319476	0.995	Inducible T-cell costimulator
2	9606.ENSP00000303939	0.989	Cytotoxic T-lymphocyte protein 4
3	9606.ENSP00000324890	0.869	T-cell-specific surface glycoprotein CD28
4	9606.ENSP00000339477	0.800	Inducible T-cell co-stimulator ligand
5	9606.ENSP00000281834	0.756	Tumor necrosis factor ligand superfamily member 4
6	9606.ENSP00000368538	0.750	Tumor necrosis factor receptor superfamily member 4
7	9606.ENSP00000361359	0.738	Tumor necrosis factor receptor superfamily member 5
8	9606.ENSP00000011653	0.723	T-cell surface glycoprotein CD4
9	9606.ENSP00000292174	0.711	C-X-C chemokine receptor type 5
10	9606.ENSP00000359663	0.711	CD40 ligand
11	9606.ENSP00000358470	0.709	V-set domain-containing T-cell activation inhibitor 1
12	9606.ENSP00000365380	0.683	Forkhead box protein P3
13	9606.ENSP00000245817	0.675	Tumor necrosis factor ligand superfamily member 9
14	9606.ENSP00000304467	0.660	Thimet oligopeptidase
15	9606.ENSP00000412237	0.659	Interleukin-10
16	9606.ENSP00000231368	0.652	Leucyl-cystinyl aminopeptidase
17	9606.ENSP00000386559	0.652	T-cell surface glycoprotein CD8 alpha chain
18	9606.ENSP00000404833	0.644	Tapasin
19	9606.ENSP00000365233	0.643	Tripeptidyl-peptidase 2
20	9606.ENSP00000384371	0.642	B-cell lymphoma 6 protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0042802	0.755	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0042102	0.997	positive regulation of T cell proliferation
GO:0046006	0.974	regulation of activated T cell proliferation
GO:0009987	0.669	cellular process
GO:0019222	0.639	regulation of metabolic process
GO:0060255	0.619	regulation of macromolecule metabolic process
GO:0050896	0.614	response to stimulus
GO:0010468	0.447	regulation of gene expression
GO:0048519	0.432	negative regulation of biological process
GO:0010604	0.405	positive regulation of macromolecule metabolic process
GO:0048523	0.402	negative regulation of cellular process
GO:0001817	0.402	regulation of cytokine production
GO:0002376	0.349	immune system process
GO:0001819	0.321	positive regulation of cytokine production
GO:0051716	0.304	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005737	0.997	cytoplasm
GO:0043229	0.997	intracellular organelle
GO:0043227	0.870	membrane-bounded organelle
GO:0099080	0.836	supramolecular complex
GO:0043228	0.835	non-membrane-bounded organelle
GO:0043232	0.829	intracellular non-membrane-bounded organelle
GO:0031982	0.822	vesicle
GO:0005576	0.808	extracellular region
GO:0035770	0.749	ribonucleoprotein granule
GO:0036464	0.741	cytoplasmic ribonucleoprotein granule
GO:0005615	0.634	extracellular space
GO:0043230	0.493	extracellular organelle
GO:0043231	0.470	intracellular membrane-bounded organelle
GO:1903561	0.461	extracellular vesicle
GO:0070062	0.450	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]