StarFunc result for job id O75145

User Input

>input (1194 residues)
MMCEVMPTISEDGRRGSALGPDEAGGELERLMVTMLTERERLLETLREAQDGLATAQLRL
RELGHEKDSLQRQLSIALPQEFAALTKELNLCREQLLEREEEIAELKAERNNTRLLLEHL
ECLVSRHERSLRMTVVKRQAQSPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRMALER
VAVLEEELELSNQETLNLREQLSRRRSGLEEPGKDGDGQTLANGLGPGGDSNRRTAELEE
ALERQRAEVCQLRERLAVLCRQMSQLEEELGTAHRELGKAEEANSKLQRDLKEALAQRED
MEERITTLEKRYLSAQREATSLHDANDKLENELASKESLYRQSEEKSRQLAEWLDDAKQK
LQQTLQKAETLPEIEAQLAQRVAALNKAEERHGNFEERLRQLEAQLEEKNQELQRARQRE
KMNDDHNKRLSETVDKLLSESNERLQLHLKERMGALEEKNSLSEEIANMKKLQDELLLNK
EQLLAEMERMQMEIDQLRGRPPSSYSRSLPGSALELRYSQAPTLPSGAHLDPYVAGSGRA
GKRGRWSGVKEEPSKDWERSAPAGSIPPPFPGELDGSDEEEAEGMFGAELLSPSGQADVQ
TLAIMLQEQLEAINKEIKLIQEEKETTEQRAEELESRVSSSGLDSLGRYRSSCSLPPSLT
TSTLASPSPPSSGHSTPRLAPPSPAREGTDKANHVPKEEAGAPRGEGPAIPGDTPPPTPR
SARLERMTQALALQAGSLEDGGPPRGSEGTPDSLHKAPKKKSIKSSIGRLFGKKEKGRMG
PPGRDSSSLAGTPSDETLATDPLGLAKLTGPGDKDRRNKRKHELLEEACRQGLPFAAWDG
PTVVSWLELWVGMPAWYVAACRANVKSGAIMANLSDTEIQREIGISNPLHRLKLRLAIQE
MVSLTSPSAPASSRTSTGNVWMTHEEMESLTATTKPETKEISWEQILAYGDMNHEWVGND
WLPSLGLPQYRSYFMESLVDARMLDHLNKKELRGQLKMVDSFHRVSLHYGIMCLKRLNYD
RKDLERRREESQTQIRDVMVWSNERVMGWVSGLGLKEFATNLTESGVHGALLALDETFDY
SDLALLLQIPTQNAQARQLLEKEFSNLISLGTDRRLDEDSAKSFSRSPSWRKMFREKDLR
GVTPDSAEMLPPNFRSAAAGALGSPGLPLRKLQPEGQTSGSSRADGVSVRTYSC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75145	1.000	1.000	0.000	1194	1.000	1.000	O75145.pdb.gz	LIPA3_HUMAN Liprin-alpha-3 OS=Homo sapiens OX=9606 GN=PPFIA3 PE=1 SV=3
2	AFDB:X1WCJ5	0.298	0.291	2.599E-100	1226	0.772	0.752	X1WCJ5.pdb.gz	X1WCJ5_DANRE Liprin-alpha-3 isoform X1 OS=Danio rerio OX=7955 GN=ppfia3 PE=3 SV=1
3	AFDB:B2RXW8	0.331	0.320	1.890E-88	1241	0.645	0.620	B2RXW8.pdb.gz	B2RXW8_MOUSE Ppfia1 protein OS=Mus musculus OX=10090 GN=Ppfia1 PE=1 SV=1
4	AFDB:B8QI36	0.407	0.409	1.372E-87	1187	0.610	0.613	B8QI36.pdb.gz	B8QI36_MOUSE Liprin-alpha 4 OS=Mus musculus OX=10090 GN=Ppfia4 PE=1 SV=1
5	AFDB:B8QI33	0.273	0.259	2.264E-86	1267	0.647	0.609	B8QI33.pdb.gz	B8QI33_MOUSE Liprin-alpha 1 OS=Mus musculus OX=10090 GN=Ppfia1 PE=2 SV=1
6	AFDB:A0A0G2K3L9	0.290	0.283	6.675E-85	1226	0.628	0.612	A0A0G2K3L9.pdb.gz	A0A0G2K3L9_RAT PTPRF interacting protein alpha 1 OS=Rattus norvegicus OX=10116 GN=Ppfia1 PE=1 SV=2
7	AFDB:F1M8A4	0.450	0.466	2.462E-84	1150	0.584	0.606	F1M8A4.pdb.gz	F1M8A4_RAT PTPRF interacting protein alpha 2 OS=Rattus norvegicus OX=10116 GN=Ppfia2 PE=1 SV=3
8	AFDB:Q13136	0.273	0.271	1.819E-82	1202	0.622	0.618	Q13136.pdb.gz	LIPA1_HUMAN Liprin-alpha-1 OS=Homo sapiens OX=9606 GN=PPFIA1 PE=1 SV=1
9	AFDB:O75335	0.348	0.351	8.543E-82	1185	0.590	0.594	O75335.pdb.gz	LIPA4_HUMAN Liprin-alpha-4 OS=Homo sapiens OX=9606 GN=PPFIA4 PE=2 SV=3
10	AFDB:M9PC73	0.263	0.269	4.061E-64	1158	0.461	0.476	M9PC73.pdb.gz	M9PC73_DROME Liprin-alpha, isoform C OS=Drosophila melanogaster OX=7227 GN=Liprin-alpha PE=1 SV=1
11	PDB:3bs5A	0.051	0.648	3.067E-1	86	0.010	0.140	3bs5A.pdb.gz
12	PDB:7cm7A	0.080	0.114	3.379E-1	620	0.038	0.073	7cm7A.pdb.gz	The NAD + -mediated self-inhibition mechanism of pro-neurodegenerative SARM1.
13	PDB:6brhB	0.056	0.129	4.099E-1	502	0.028	0.066	6brhB.pdb.gz	The SAM domain of mouse SAMHD1 is critical for its activation and regulation.
14	PDB:7anwA	0.067	0.107	4.516E-1	645	0.024	0.045	7anwA.pdb.gz	Structural basis for SARM1 inhibition and activation under energetic stress.
15	PDB:7zs9M	0.052	0.162	9.786E-1	310	0.026	0.100	7zs9M.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
16	PDB:7n6g3I	0.076	0.180	1.027	401	0.057	0.170	7n6g3I.pdb.gz	Cryo-EM structure of an active central apparatus.
17	PDB:7bc7A	0.074	0.145	1.246	432	0.033	0.090	7bc7A.pdb.gz	Structural basis of antifolate recognition and transport by PCFT.
18	PDB:7sqcO1	0.077	0.122	1.512	673	0.050	0.089	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
19	PDB:5iy6M	0.061	0.170	1.835	260	0.026	0.119	5iy6M.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
20	PDB:5nikD	0.059	0.168	2.226	340	0.014	0.050	5nikD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A087WPJ3	983	892	0.446	0.598	A0A087WPJ3_MOUSE Protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF),-interacting protein (liprin), alpha 4 (Fragment) OS=Mus musculus OX=10090 GN=Ppfia4 PE=1 SV=1
2	A0A087WPM2	1292	1184	0.603	0.608	A0A087WPM2_MOUSE Protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF),-interacting protein (liprin), alpha 4 OS=Mus musculus OX=10090 GN=Ppfia4 PE=1 SV=1
3	A0A0G2K3L9	1259	1142	0.589	0.616	A0A0G2K3L9_RAT PTPRF interacting protein alpha 1 OS=Rattus norvegicus OX=10116 GN=Ppfia1 PE=1 SV=2
4	A0A1B0GWM2	1323	1218	0.619	0.607	A0A1B0GWM2_RAT PTPRF interacting protein alpha 1 OS=Rattus norvegicus OX=10116 GN=Ppfia1 PE=1 SV=2
5	A0A1B0GWS0	1422	1266	0.661	0.623	A0A1B0GWS0_RAT PTPRF interacting protein alpha 1 OS=Rattus norvegicus OX=10116 GN=Ppfia1 PE=1 SV=1
6	A0A2R8Y7R9	1392	1224	0.642	0.627	A0A2R8Y7R9_HUMAN PTPRF interacting protein alpha 1 (Fragment) OS=Homo sapiens OX=9606 GN=PPFIA1 PE=1 SV=1
7	A0A8I6AK94	1328	1261	0.627	0.594	A0A8I6AK94_RAT PTPRF interacting protein alpha 2 OS=Rattus norvegicus OX=10116 GN=Ppfia2 PE=3 SV=1
8	A0A8I6AM56	1321	1246	0.618	0.592	A0A8I6AM56_RAT PTPRF interacting protein alpha 2 OS=Rattus norvegicus OX=10116 GN=Ppfia2 PE=3 SV=1
9	B2RXQ2	1420	1266	0.660	0.622	B2RXQ2_MOUSE Ppfia1 protein OS=Mus musculus OX=10090 GN=Ppfia1 PE=1 SV=1
10	B2RXW8	1433	1241	0.660	0.635	B2RXW8_MOUSE Ppfia1 protein OS=Mus musculus OX=10090 GN=Ppfia1 PE=1 SV=1
11	B8QI33	1415	1267	0.660	0.622	B8QI33_MOUSE Liprin-alpha 1 OS=Mus musculus OX=10090 GN=Ppfia1 PE=2 SV=1
12	B8QI36	1306	1187	0.616	0.619	B8QI36_MOUSE Liprin-alpha 4 OS=Mus musculus OX=10090 GN=Ppfia4 PE=1 SV=1
13	D3ZZ81	1359	1190	0.631	0.633	D3ZZ81_RAT PTPRF interacting protein alpha 1 OS=Rattus norvegicus OX=10116 GN=Ppfia1 PE=1 SV=1
14	F1M8A4	1255	1126	0.572	0.607	F1M8A4_RAT PTPRF interacting protein alpha 2 OS=Rattus norvegicus OX=10116 GN=Ppfia2 PE=1 SV=3
15	M9PC73	917	1158	0.479	0.494	M9PC73_DROME Liprin-alpha, isoform C OS=Drosophila melanogaster OX=7227 GN=Liprin-alpha PE=1 SV=1
16	M9PCD4	954	1214	0.495	0.487	M9PCD4_DROME Liprin-alpha, isoform E OS=Drosophila melanogaster OX=7227 GN=Liprin-alpha PE=1 SV=1
17	M9PCR7	950	1205	0.492	0.487	M9PCR7_DROME Liprin-alpha, isoform D OS=Drosophila melanogaster OX=7227 GN=Liprin-alpha PE=1 SV=1
18	O75145	2402	1194	1.000	1.000	LIPA3_HUMAN Liprin-alpha-3 OS=Homo sapiens OX=9606 GN=PPFIA3 PE=1 SV=3
19	O75334	1336	1257	0.627	0.596	LIPA2_HUMAN Liprin-alpha-2 OS=Homo sapiens OX=9606 GN=PPFIA2 PE=1 SV=2
20	O75335	1235	1185	0.598	0.603	LIPA4_HUMAN Liprin-alpha-4 OS=Homo sapiens OX=9606 GN=PPFIA4 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05335 DUF745	16	16.7	Protein of unknown function (DUF745)
2	PF04399 Glutaredoxin2_C	4.3e+02	12.1	Glutaredoxin 2, C terminal domain
3	PF00536 SAM_1	4.6e-19	79.9	SAM domain (Sterile alpha motif)
4	PF07647 SAM_2	2.5e-19	80.4	SAM domain (Sterile alpha motif)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000335614

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000418447	0.993	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
2	9606.ENSP00000353030	0.989	Receptor-type tyrosine-protein phosphatase F
3	9606.ENSP00000367408	0.976	Peripheral plasma membrane protein CASK
4	9606.ENSP00000370593	0.962	Receptor-type tyrosine-protein phosphatase delta
5	9606.ENSP00000265381	0.955	Amyloid-beta A4 precursor protein-binding family A member 1
6	9606.ENSP00000447488	0.938	Protein lin-7 homolog A
7	9606.ENSP00000349932	0.928	Receptor-type tyrosine-protein phosphatase S
8	9606.ENSP00000468263	0.925	ELKS/Rab6-interacting/CAST family member 1
9	9606.ENSP00000221459	0.921	Protein lin-7 homolog B
10	9606.ENSP00000278193	0.920	Protein lin-7 homolog C
11	9606.ENSP00000367756	0.902	Protein unc-13 homolog B
12	9606.ENSP00000428417	0.882	Regulating synaptic membrane exocytosis protein 1
13	9606.ENSP00000288221	0.879	ERC protein 2
14	9606.ENSP00000378338	0.860	ARF GTPase-activating protein GIT1
15	9606.ENSP00000222812	0.838	Syntaxin-1A
16	9606.ENSP00000438388	0.834	Kinesin-like protein KIF1A
17	9606.ENSP00000299492	0.828	Liprin-beta-2
18	9606.ENSP00000314724	0.827	Liprin-beta-1
19	9606.ENSP00000222256	0.808	Ras-related protein Rab-3A
20	9606.ENSP00000305613	0.798	Complexin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.986	biological regulation
GO:0009987	0.967	cellular process
GO:0065008	0.967	regulation of biological quality
GO:0050794	0.960	regulation of cellular process
GO:0007268	0.919	chemical synaptic transmission
GO:0001505	0.878	regulation of neurotransmitter levels
GO:0032940	0.869	secretion by cell
GO:0007269	0.863	neurotransmitter secretion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043227	0.999	membrane-bounded organelle
GO:0045202	0.998	synapse
GO:0043229	0.997	intracellular organelle
GO:0012505	0.996	endomembrane system
GO:0098793	0.992	presynapse
GO:0043231	0.990	intracellular membrane-bounded organelle
GO:0031410	0.984	cytoplasmic vesicle
GO:0005829	0.977	cytosol
GO:0016020	0.966	membrane
GO:0099503	0.962	secretory vesicle
GO:0071944	0.929	cell periphery
GO:0001669	0.918	acrosomal vesicle
GO:0048786	0.657	presynaptic active zone
GO:0005886	0.619	plasma membrane
GO:0005576	0.613	extracellular region
GO:0032991	0.608	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]