StarFunc result for job id O75146

User Input

>input (1068 residues)
MNSIKNVPARVLSRRPGHSLEAEREQFDKTQAISISKAINTQEAPVKEKHARRIILGTHH
EKGAFTFWSYAIGLPLPSSSILSWKFCHVLHKVLRDGHPNVLHDCQRYRSNIREIGDLWG
HLHDRYGQLVNVYTKLLLTKISFHLKHPQFPAGLEVTDEVLEKAAGTDVNNIFQLTVEMF
DYMDCELKLSESVFRQLNTAIAVSQMSSGQCRLAPLIQVIQDCSHLYHYTVKLLFKLHSC
LPADTLQGHRDRFHEQFHSLRNFFRRASDMLYFKRLIQIPRLPEGPPNFLRASALAEHIK
PVVVIPEEAPEDEEPENLIEISTGPPAGEPVVVADLFDQTFGPPNGSVKDDRDLQIESLK
REVEMLRSELEKIKLEAQRYIAQLKSQVNALEGELEEQRKQKQKALVDNEQLRHELAQLR
AAQLEGERSQGLREEAERKASATEARYNKLKEKHSELVHVHAELLRKNADTAKQLTVTQQ
SQEEVARVKEQLAFQVEQVKRESELKLEEKSDQLEKLKRELEAKAGELARAQEALSHTEQ
SKSELSSRLDTLSAEKDALSGAVRQREADLLAAQSLVRETEAALSREQQRSSQEQGELQG
RLAERESQEQGLRQRLLDEQFAVLRGAAAEAAGILQDAVSKLDDPLHLRCTSSPDYLVSR
AQEALDAVSTLEEGHAQYLTSLADASALVAALTRFSHLAADTIINGGATSHLAPTDPADR
LIDTCRECGARALELMGQLQDQQALRHMQASLVRTPLQGILQLGQELKPKSLDVRQEELG
AVVDKEMAATSAAIEDAVRRIEDMMNQARHASSGVKLEVNERILNSCTDLMKAIRLLVTT
STSLQKEIVESGRGAATQQEFYAKNSRWTEGLISASKAVGWGATQLVEAADKVVLHTGKY
EELIVCSHEIAASTAQLVAASKVKANKHSPHLSRLQECSRTVNERAANVVASTKSGQEQI
EDRDTMDFSGLSLIKLKKQEMETQVRVLELEKTLEAERMRLGELRKQHYVLAGASGSPGE
EVAIRPSTAPRSVTTKKPPLAQKPSVAPRQDHQLDKKDGIYPAQLVNY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1MUI0	0.467	0.464	0.000	1076	0.911	0.904	F1MUI0.pdb.gz	F1MUI0_BOVIN Huntingtin interacting protein 1 related OS=Bos taurus OX=9913 GN=HIP1R PE=1 SV=2
2	AFDB:Q99PW9	0.461	0.456	0.000	1079	0.910	0.901	Q99PW9.pdb.gz	Q99PW9_RAT Huntingtin interacting protein 1 related (Fragment) OS=Rattus norvegicus OX=10116 GN=Hip1r PE=2 SV=1
3	AFDB:A0A2R8QB02	0.376	0.379	1.092E-77	1056	0.505	0.510	A0A2R8QB02.pdb.gz
4	AFDB:O00291	0.333	0.342	1.144E-76	1037	0.494	0.509	O00291.pdb.gz	HIP1_HUMAN Huntingtin-interacting protein 1 OS=Homo sapiens OX=9606 GN=HIP1 PE=1 SV=5
5	AFDB:G3V8Y8	0.329	0.338	2.310E-73	1030	0.480	0.498	G3V8Y8.pdb.gz	G3V8Y8_RAT Huntingtin interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Hip1 PE=3 SV=2
6	AFDB:Q02328	0.290	0.331	1.643E-52	927	0.314	0.361	Q02328.pdb.gz	SLAP2_CAEEL Huntington interacting protein related 1 OS=Caenorhabditis elegans OX=6239 GN=hipr-1 PE=3 SV=3
7	AFDB:Q9P6L5	0.280	0.274	1.766E-40	1102	0.255	0.247	Q9P6L5.pdb.gz	SLA2_SCHPO Endocytosis protein end4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=end4 PE=1 SV=2
8	AFDB:Q2U538	0.312	0.296	3.541E-40	1136	0.250	0.235	Q2U538.pdb.gz	Q2U538_ASPOR Cytoskeleton assembly control protein Sla2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090020000087 PE=3 SV=1
9	AFDB:A0A1D8PRF5	0.272	0.272	1.428E-38	1063	0.248	0.249	A0A1D8PRF5.pdb.gz	A0A1D8PRF5_CANAL Sla2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SLA2 PE=3 SV=1
10	AFDB:Q1ZXE9	0.229	0.254	2.788E-31	960	0.210	0.233	Q1ZXE9.pdb.gz	Q1ZXE9_DICDI I/LWEQ domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=hipA PE=3 SV=1
11	PDB:6r9tA	0.209	0.116	1.777E-8	2185	0.072	0.035	6r9tA.pdb.gz
12	PDB:3ay5A	0.110	0.327	4.472E-4	298	0.035	0.124	3ay5A.pdb.gz
13	PDB:4iggB	0.065	0.082	4.303E-2	771	0.055	0.077	4iggB.pdb.gz
14	PDB:6xz6A	0.055	0.160	1.333E-1	213	0.026	0.131	6xz6A.pdb.gz
15	PDB:4k1nA	0.086	0.164	1.392E-1	520	0.051	0.106	4k1nA.pdb.gz
16	PDB:7n6g6A	0.081	0.060	1.392E-1	1558	0.137	0.094	7n6g6A.pdb.gz	Cryo-EM structure of an active central apparatus.
17	PDB:6fuyA	0.094	0.103	1.657E-1	961	0.047	0.052	6fuyA.pdb.gz
18	PDB:6c0fz	0.099	0.240	2.059E-1	243	0.023	0.103	6c0fz.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.
19	PDB:6nr7A	0.078	0.077	2.559E-1	1086	0.040	0.040	6nr7A.pdb.gz	Refined model of chicken vinculin suggests the mechanism of activation by helical super-bundle unfurling
20	PDB:1x8zA	0.095	0.512	3.785E-1	151	0.013	0.093	1x8zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5Y6T0	0.0	946	1008	0.477	0.505	A0A8I5Y6T0_RAT Huntingtin interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Hip1 PE=1 SV=1
2	A0A8I6AA26	0.0	947	1004	0.477	0.507	A0A8I6AA26_RAT Huntingtin interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Hip1 PE=1 SV=1
3	A0A8I6GA90	0.0	930	1015	0.479	0.504	A0A8I6GA90_RAT Huntingtin interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Hip1 PE=1 SV=1
4	B5DFK5	0.0	1980	1068	0.919	0.919	B5DFK5_RAT Hip1r protein OS=Rattus norvegicus OX=10116 GN=Hip1r PE=2 SV=1
5	C9K4U5	0.0	1064	1046	0.508	0.519	C9K4U5_DANRE Huntingtin-interacting protein 1 OS=Danio rerio OX=7955 GN=wu:fb98d04 PE=1 SV=1
6	F1LML7	0.0	1976	1069	0.919	0.919	F1LML7_RAT Huntingtin interacting protein 1 related OS=Rattus norvegicus OX=10116 GN=Hip1r PE=1 SV=1
7	F1MUI0	0.0	1954	1076	0.912	0.905	F1MUI0_BOVIN Huntingtin interacting protein 1 related OS=Bos taurus OX=9913 GN=HIP1R PE=1 SV=2
8	F1R6L2	0.0	1062	1048	0.507	0.517	F1R6L2_DANRE Huntingtin-interacting protein 1 OS=Danio rerio OX=7955 GN=wu:fb98d04 PE=1 SV=3
9	G3V8Y8	0.0	970	1038	0.493	0.508	G3V8Y8_RAT Huntingtin interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Hip1 PE=3 SV=2
10	O00291	0.0	1007	1037	0.497	0.512	HIP1_HUMAN Huntingtin-interacting protein 1 OS=Homo sapiens OX=9606 GN=HIP1 PE=1 SV=5
11	O75146	0.0	2181	1068	1.000	1.000	HIP1R_HUMAN Huntingtin-interacting protein 1-related protein OS=Homo sapiens OX=9606 GN=HIP1R PE=1 SV=2
12	Q8VD75	0.0	969	1029	0.493	0.511	HIP1_MOUSE Huntingtin-interacting protein 1 OS=Mus musculus OX=10090 GN=Hip1 PE=1 SV=2
13	Q99PW9	0.0	1955	1079	0.914	0.905	Q99PW9_RAT Huntingtin interacting protein 1 related (Fragment) OS=Rattus norvegicus OX=10116 GN=Hip1r PE=2 SV=1
14	Q9JKY5	0.0	1937	1068	0.909	0.909	HIP1R_MOUSE Huntingtin-interacting protein 1-related protein OS=Mus musculus OX=10090 GN=Hip1r PE=1 SV=2
15	Q8VHU1	2.74e-91	293	230	0.140	0.648	Q8VHU1_RAT HIP1 protein (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
16	Q02328	1.27e-82	290	927	0.159	0.183	SLAP2_CAEEL Huntington interacting protein related 1 OS=Caenorhabditis elegans OX=6239 GN=hipr-1 PE=3 SV=3
17	Q2U538	4.55e-70	257	1136	0.269	0.253	Q2U538_ASPOR Cytoskeleton assembly control protein Sla2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090020000087 PE=3 SV=1
18	A0A1D8PRF5	1.93e-34	145	1063	0.087	0.087	A0A1D8PRF5_CANAL Sla2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SLA2 PE=3 SV=1
19	Q9P6L5	1.15e-27	123	1102	0.069	0.067	SLA2_SCHPO Endocytosis protein end4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=end4 PE=1 SV=2
20	Q1ZXE9	5.15e-25	115	960	0.122	0.135	Q1ZXE9_DICDI I/LWEQ domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=hipA PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07651 ANTH	1.5e-73	258.8	ANTH domain
2	PF16515 HIP1_clath_bdg	1.6e-25	100.6	Clathrin-binding domain of Huntingtin-interacting protein 1
3	PF01608 I_LWEQ	4.4e-47	171.4	I/LWEQ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000253083

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365745	0.996	Contributes to the organization of the actin cytoskeleton and cell shape . Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones (By similarity). Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density (By similarity). Plays a role in the invasiveness of cancer cells, and the formation of metastases . Plays a role in focal adhesion assembly and turnover (By similarity). In complex with ABL1 and MYLK regulates cortical actin-based cyto [...]
2	9606.ENSP00000479606	0.979	Clathrin heavy chain 1
3	9606.ENSP00000314499	0.973	Cyclin-G-associated kinase
4	9606.ENSP00000347184	0.973	Huntingtin
5	9606.ENSP00000309415	0.963	Clathrin light chain B
6	9606.ENSP00000377015	0.960	Phosphatidylinositol-binding clathrin assembly protein
7	9606.ENSP00000400459	0.951	Clathrin coat assembly protein AP180
8	9606.ENSP00000242285	0.943	Clathrin light chain A
9	9606.ENSP00000368831	0.920	Sorting nexin-2
10	9606.ENSP00000261842	0.917	AP-4 complex subunit epsilon-1
11	9606.ENSP00000417653	0.917	Drebrin-like protein
12	9606.ENSP00000265970	0.913	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha
13	9606.ENSP00000358582	0.910	AP-4 complex subunit beta-1
14	9606.ENSP00000255194	0.907	AP-3 complex subunit beta-1
15	9606.ENSP00000325369	0.905	AP-3 complex subunit sigma-1
16	9606.ENSP00000256637	0.903	Sortilin
17	9606.ENSP00000366998	0.902	Sorting nexin-5
18	9606.ENSP00000225719	0.901	M14 carboxypeptidases
19	9606.ENSP00000357674	0.900	SNARE-associated protein Snapin
20	9606.ENSP00000417573	0.900	Protein YIPF6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.986	cytoskeletal protein binding
GO:0051015	0.978	actin filament binding
GO:0030276	0.857	clathrin binding
GO:0042802	0.359	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0071840	0.979	cellular component organization or biogenesis
GO:0016043	0.974	cellular component organization
GO:0065007	0.907	biological regulation
GO:0050789	0.899	regulation of biological process
GO:0050794	0.894	regulation of cellular process
GO:0051179	0.757	localization
GO:0006810	0.579	transport
GO:0048518	0.531	positive regulation of biological process
GO:0048522	0.476	positive regulation of cellular process
GO:0019222	0.467	regulation of metabolic process
GO:0051128	0.443	regulation of cellular component organization
GO:0050896	0.402	response to stimulus
GO:0048519	0.394	negative regulation of biological process
GO:0060255	0.392	regulation of macromolecule metabolic process
GO:0051641	0.379	cellular localization
GO:0016192	0.378	vesicle-mediated transport
GO:0006996	0.373	organelle organization
GO:0006897	0.352	endocytosis
GO:0080090	0.326	regulation of primary metabolic process
GO:0051171	0.326	regulation of nitrogen compound metabolic process
GO:0048523	0.305	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005886	0.997	plasma membrane
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0031982	0.995	vesicle
GO:0012505	0.994	endomembrane system
GO:0030054	0.992	cell junction
GO:0005829	0.985	cytosol
GO:0098590	0.985	plasma membrane region
GO:0045202	0.983	synapse
GO:0043232	0.963	intracellular non-membrane-bounded organelle
GO:0098978	0.934	glutamatergic synapse
GO:0031410	0.928	cytoplasmic vesicle
GO:0098794	0.883	postsynapse
GO:0005856	0.623	cytoskeleton
GO:0030135	0.608	coated vesicle
GO:0005794	0.566	Golgi apparatus
GO:0070013	0.496	intracellular organelle lumen
GO:0030136	0.455	clathrin-coated vesicle
GO:0070062	0.420	extracellular exosome
GO:0031981	0.378	nuclear lumen
GO:0042995	0.374	cell projection
GO:0032991	0.325	protein-containing complex
GO:0005938	0.302	cell cortex
GO:0005905	0.302	clathrin-coated pit

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]