StarFunc result for job id O75147

User Input

>input (1896 residues)
MKASSGDQGSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSF
PADGAEHGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPS
PGSGEGAPVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQ
PGRAEDGPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEA
PAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDG
GFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVL
ECKVPNSRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRT
VANVTVKGPILKRLPRKLDVLEGENAVLLVETLEAGVEGRWSRDGEELPVICQSSSGHMH
ALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKP
PEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGR
SPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTIIQGTWFLNGEELKSNEPE
GQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSP
QDRVSLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKV
QDSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVRW
YKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIV
YPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAV
QLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPV
RWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPER
IVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTL
PHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRA
GAPVVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTV
QVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQA
GARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFR
CEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSA
RLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQ
DGHIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQ
LELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAA
RLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPSPRLRLQALG
TRRLLQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFEC
TVSEVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLAL
LEVEALPLQMCRHPPREKTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHG
PTHSLVIHDVRPEDQGTYCCQAGQDSTHTRLLVEGN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZZ80	0.169	0.175	0.000	1805	0.839	0.881	D3ZZ80.pdb.gz	OBSL1_RAT Obscurin-like protein 1 OS=Rattus norvegicus OX=10116 GN=Obsl1 PE=2 SV=3
2	AFDB:O75147	1.000	1.000	0.000	1896	1.000	1.000	O75147.pdb.gz	OBSL1_HUMAN Obscurin-like protein 1 OS=Homo sapiens OX=9606 GN=OBSL1 PE=1 SV=4
3	AFDB:A0A140LGX4	0.114	0.189	6.495E-87	1010	0.164	0.308	A0A140LGX4.pdb.gz
4	AFDB:Q15746	0.081	0.080	2.061E-57	1914	0.162	0.160	Q15746.pdb.gz	MYLK_HUMAN Myosin light chain kinase, smooth muscle OS=Homo sapiens OX=9606 GN=MYLK PE=1 SV=4
5	AFDB:Q6PDN3	0.066	0.064	1.925E-55	1941	0.166	0.162	Q6PDN3.pdb.gz	MYLK_MOUSE Myosin light chain kinase, smooth muscle OS=Mus musculus OX=10090 GN=Mylk PE=1 SV=3
6	AFDB:F1NY98	0.096	0.091	4.381E-54	2034	0.146	0.136	F1NY98.pdb.gz	DSCAM_CHICK Cell adhesion molecule DSCAM OS=Gallus gallus OX=9031 GN=DSCAM PE=1 SV=3
7	AFDB:A7LCJ3	0.079	0.085	2.534E-53	1730	0.164	0.179	A7LCJ3.pdb.gz	SN_PIG Sialoadhesin OS=Sus scrofa OX=9823 GN=SIGLEC1 PE=1 SV=1
8	AFDB:Q7ZZ47	0.089	0.214	5.025E-53	670	0.078	0.221	Q7ZZ47.pdb.gz
9	AFDB:Q90688	0.078	0.107	5.964E-53	1272	0.105	0.157	Q90688.pdb.gz	MYPC3_CHICK Myosin-binding protein C, cardiac-type OS=Gallus gallus OX=9031 GN=MYBPC3 PE=1 SV=3
10	AFDB:Q62230	0.103	0.111	1.235E-52	1695	0.155	0.173	Q62230.pdb.gz	SN_MOUSE Sialoadhesin OS=Mus musculus OX=10090 GN=Siglec1 PE=1 SV=2
11	PDB:5oj2B	0.073	0.136	8.581E-22	692	0.068	0.185	5oj2B.pdb.gz
12	PDB:1e07A	0.059	0.139	7.613E-21	642	0.054	0.160	1e07A.pdb.gz
13	PDB:7sqcO0	0.087	0.121	4.442E-19	1140	0.056	0.093	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
14	PDB:5a42A	0.067	0.076	2.242E-14	1597	0.073	0.086	5a42A.pdb.gz
15	PDB:2rcjC	0.094	0.234	1.765E-12	523	0.039	0.141	2rcjC.pdb.gz
16	PDB:7q5zA	0.077	0.102	1.843E-12	1344	0.045	0.063	7q5zA.pdb.gz
17	PDB:7q1yA	0.065	0.083	3.214E-12	1374	0.053	0.073	7q1yA.pdb.gz
18	PDB:6dldD	0.052	0.278	6.376E-12	269	0.031	0.216	6dldD.pdb.gz
19	PDB:4ziqA	0.068	0.079	2.977E-11	1450	0.051	0.067	4ziqA.pdb.gz
20	PDB:6h03A	0.085	0.108	4.192E-11	1223	0.047	0.073	6h03A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JUP3	0.0	628	7329	0.285	0.074	A0A0G2JUP3_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Obscn PE=1 SV=2
2	A6NGQ3	0.0	712	8923	0.301	0.064	A6NGQ3_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=OBSCN PE=1 SV=5
3	D3ZZ80	0.0	1318	1805	0.384	0.404	OBSL1_RAT Obscurin-like protein 1 OS=Rattus norvegicus OX=10116 GN=Obsl1 PE=2 SV=3
4	O75147	0.0	3812	1896	1.000	1.000	OBSL1_HUMAN Obscurin-like protein 1 OS=Homo sapiens OX=9606 GN=OBSL1 PE=1 SV=4
5	Q5VST9	0.0	817	7968	0.308	0.073	OBSCN_HUMAN Obscurin OS=Homo sapiens OX=9606 GN=OBSCN PE=1 SV=3
6	A2AAJ9	3.95e-180	611	8886	0.282	0.060	OBSCN_MOUSE Obscurin OS=Mus musculus OX=10090 GN=Obscn PE=1 SV=3
7	A2ASS6	2.75e-134	471	35213	0.206	0.011	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
8	A0A8I5ZU83	2.09e-133	469	26931	0.205	0.014	A0A8I5ZU83_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
9	A0A8I5ZUN3	5.75e-133	467	35375	0.205	0.011	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
10	Q8WZ42	6.11e-133	467	34350	0.207	0.011	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4
11	Q7TN00	5.77e-89	327	3410	0.243	0.135	Q7TN00_RAT Cardiac titin N2BA isoform (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=2
12	A0A8I6A794	2.27e-78	292	5475	0.168	0.058	A0A8I6A794_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
13	Q96RW7	3.44e-78	291	5635	0.259	0.087	HMCN1_HUMAN Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1 SV=2
14	A2AJ76	3.26e-74	279	5100	0.274	0.102	HMCN2_MOUSE Hemicentin-2 OS=Mus musculus OX=10090 GN=Hmcn2 PE=1 SV=1
15	D3YXG0	2.77e-66	253	5634	0.230	0.077	HMCN1_MOUSE Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=1 SV=1
16	E7F3V2	2.77e-66	253	4212	0.257	0.116	E7F3V2_DANRE Hemicentin 2 OS=Danio rerio OX=7955 GN=hmcn2 PE=1 SV=2
17	O01761	3.52e-61	236	8081	0.251	0.059	UNC89_CAEEL Muscle M-line assembly protein unc-89 OS=Caenorhabditis elegans OX=6239 GN=unc-89 PE=1 SV=3
18	Q8NDA2	2.87e-56	220	5059	0.257	0.096	HMCN2_HUMAN Hemicentin-2 OS=Homo sapiens OX=9606 GN=HMCN2 PE=2 SV=3
19	A8DYP0	3.91e-51	203	4218	0.214	0.096	OBSCN_DROME Obscurin OS=Drosophila melanogaster OX=7227 GN=Unc-89 PE=1 SV=1
20	G5ED27	8.39e-50	198	5175	0.228	0.084	G5ED27_CAEEL Ig-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=him-4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06832 BiPBP_C	2.6e-14	64.4	Penicillin-Binding Protein C-terminus Family
2	PF07654 C1-set	2.8e-06	38.9	Immunoglobulin C1-set domain
3	PF08205 C2-set_2	3.1e-15	67.3	CD80-like C2-set immunoglobulin domain
4	PF00041 fn3	2.7	19.7	Fibronectin type III domain
5	PF07679 I-set	6e-185	611.3	Immunoglobulin I-set domain
6	PF00047 ig	1.7e-85	292.6	Immunoglobulin domain
7	PF13895 Ig_2	6.6e-85	290.8	Immunoglobulin domain
8	PF13927 Ig_3	6.3e-140	467.4	Immunoglobulin domain
9	PF16680 Ig_4	8.9e-16	69.6	T-cell surface glycoprotein CD3 delta chain
10	PF16681 Ig_5	1.6e-16	71.8	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
11	PF18452 Ig_6	5.9e-13	60.2	Immunoglobulin domain
12	PF17736 Ig_C17orf99	0.046	25.1	C17orf99 Ig domain
13	PF16706 Izumo-Ig	1.2e-20	84.6	Izumo-like Immunoglobulin domain
14	PF11465 Receptor_2B4	0.27	22.8	Natural killer cell receptor 2B4
15	PF07686 V-set	3.3e-41	151.3	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385636

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000303158	0.999	Coiled-coil domain-containing protein 8
2	9606.ENSP00000438788	0.999	Cullin-7
3	9606.ENSP00000467141	0.973	Titin
4	9606.ENSP00000441543	0.923	Polyubiquitin-C
5	9606.ENSP00000272317	0.900	Ubiquitin-40S ribosomal protein S27a
6	9606.ENSP00000301633	0.900	Baculoviral IAP repeat containing 5
7	9606.ENSP00000304697	0.900	Polyubiquitin-B
8	9606.ENSP00000388107	0.900	Ubiquitin-60S ribosomal protein L40
9	9606.ENSP00000310686	0.883	F-box/WD repeat-containing protein 8
10	9606.ENSP00000252050	0.846	Cullin-9
11	9606.ENSP00000269305	0.765	Cellular tumor antigen p53
12	9606.ENSP00000216225	0.748	E3 ubiquitin-protein ligase RBX1
13	9606.ENSP00000327145	0.721	Filamin-C
14	9606.ENSP00000229795	0.687	Mitogen-activated protein kinase 14
15	9606.ENSP00000250495	0.627	NEDD8
16	9606.ENSP00000258888	0.613	Alpha-protein kinase 3
17	9606.ENSP00000290341	0.612	Insulin-like growth factor 2 mRNA-binding protein 1
18	9606.ENSP00000196061	0.591	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1
19	9606.ENSP00000374037	0.561	VPS9 domain containing 1
20	9606.ENSP00000402338	0.560	Ribosome production factor 2 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050789	0.985	regulation of biological process
GO:0016043	0.979	cellular component organization
GO:0050794	0.972	regulation of cellular process
GO:0048814	0.720	regulation of dendrite morphogenesis
GO:0048522	0.715	positive regulation of cellular process
GO:0050775	0.709	positive regulation of dendrite morphogenesis
GO:0010256	0.671	endomembrane system organization
GO:0007030	0.648	Golgi organization
GO:0051179	0.318	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0099080	0.987	supramolecular complex
GO:0043231	0.979	intracellular membrane-bounded organelle
GO:0099512	0.973	supramolecular fiber
GO:0043292	0.964	contractile fiber
GO:0005856	0.960	cytoskeleton
GO:0070013	0.926	intracellular organelle lumen
GO:0030016	0.923	myofibril
GO:0030017	0.888	sarcomere
GO:0031430	0.846	M band
GO:0005634	0.805	nucleus
GO:0032991	0.744	protein-containing complex
GO:0012505	0.721	endomembrane system
GO:0070161	0.554	anchoring junction
GO:0031674	0.494	I band
GO:0071944	0.450	cell periphery
GO:0030018	0.419	Z disc
GO:1990393	0.388	3M complex
GO:0005911	0.388	cell-cell junction
GO:0031981	0.366	nuclear lumen
GO:0016020	0.357	membrane
GO:0015630	0.344	microtubule cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]