StarFunc result for job id O75150

User Input

>input (1001 residues)
MSGPGNKRAAGDGGSGPPEKKLSREEKTTTTLIEPIRLGGISSTEEMDLKVLQFKNKKLA
ERLEQRQACEDELRERIEKLEKRQATDDATLLIVNRYWAQLDETVEALLRCHESQGELSS
APEAPGTQEGPTCDGTPLPEPGTSELRDPLLMQLRPPLSEPALAFVVALGASSSEEVELE
LQGRMEFSKAAVSRVVEASDRLQRRVEELCQRVYSRGDSEPLSEAAQAHTRELGRENRRL
QDLATQLQEKHHRISLEYSELQDKVTSAETKVLEMETTVEDLQWDIEKLRKREQKLNKHL
AEALEQLNSGYYVSGSSSGFQGGQITLSMQKFEMLNAELEENQELANSRMAELEKLQAEL
QGAVRTNERLKVALRSLPEEVVRETGEYRMLQAQFSLLYNESLQVKTQLDEARGLLLATK
NSHLRHIEHMESDELGLQKKLRTEVIQLEDTLAQVRKEYEMLRIEFEQNLAANEQAGPIN
REMRHLISSLQNHNHQLKGDAQRYKRKLREVQAEIGKLRAQASGSAHSTPNLGHPEDSGV
SAPAPGKEEGGPGPVSTPDNRKEMAPVPGTTTTTTSVKKEELVPSEEDFQGITPGAQGPS
SRGREPEARPKRELREREGPSLGPPPVASALSRADREKAKVEETKRKESELLKGLRAELK
KAQESQKEMKLLLDMYKSAPKEQRDKVQLMAAERKAKAEVDELRSRIRELEERDRRESKK
IADEDALRRIRQAEEQIEHLQRKLGATKQEEEALLSEMDVTGQAFEDMQEQNGRLLQQLR
EKDDANFKLMSERIKANQIHKLLREEKDELGEQVLGLKSQVDAQLLTVQKLEEKERALQG
SLGGVEKELTLRSQALELNKRKAVEAAQLAEDLKVQLEHVQTRLREIQPCLAESRAAREK
ESFNLKRAQEDISRLRRKLEKQRKVEVYADADEILQEEIKEYKARLTCPCCNTRKKDAVL
TKCFHVFCFECVRGRYEARQRKCPKCNAAFGAHDFHRIYIS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:H3BP71	0.331	0.342	0.000	961	0.953	0.993	H3BP71.pdb.gz	H3BP71_HUMAN E3 ubiquitin protein ligase OS=Homo sapiens OX=9606 GN=RNF40 PE=1 SV=2
2	AFDB:Q8CJB9	0.678	0.677	0.000	1002	0.926	0.925	Q8CJB9.pdb.gz	BRE1B_RAT E3 ubiquitin-protein ligase BRE1B OS=Rattus norvegicus OX=10116 GN=Rnf40 PE=1 SV=1
3	AFDB:Q5VTR2	0.349	0.357	5.396E-66	975	0.577	0.593	Q5VTR2.pdb.gz	BRE1A_HUMAN E3 ubiquitin-protein ligase BRE1A OS=Homo sapiens OX=9606 GN=RNF20 PE=1 SV=2
4	AFDB:Q9VRP9	0.209	0.203	2.177E-53	1044	0.454	0.435	Q9VRP9.pdb.gz	BRE1_DROME E3 ubiquitin-protein ligase Bre1 OS=Drosophila melanogaster OX=7227 GN=Bre1 PE=1 SV=2
5	AFDB:Q8RXD6	0.189	0.213	3.963E-20	878	0.196	0.223	Q8RXD6.pdb.gz	BRE1A_ARATH E3 ubiquitin-protein ligase BRE1-like 1 OS=Arabidopsis thaliana OX=3702 GN=HUB1 PE=1 SV=1
6	AFDB:P34537	0.220	0.247	1.352E-19	837	0.199	0.238	P34537.pdb.gz	BRE1_CAEEL E3 ubiquitin-protein ligase bre-1 OS=Caenorhabditis elegans OX=6239 GN=rfp-1 PE=1 SV=2
7	AFDB:Q9C895	0.250	0.271	8.523E-19	900	0.188	0.209	Q9C895.pdb.gz	BRE1B_ARATH E3 ubiquitin-protein ligase BRE1-like 2 OS=Arabidopsis thaliana OX=3702 GN=HUB2 PE=1 SV=2
8	AFDB:O74563	0.150	0.200	7.657E-8	680	0.132	0.194	O74563.pdb.gz	BRL2_SCHPO E3 ubiquitin-protein ligase brl2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=brl2 PE=1 SV=1
9	AFDB:Q1MTQ0	0.150	0.212	5.456E-7	692	0.140	0.202	Q1MTQ0.pdb.gz	BRL1_SCHPO E3 ubiquitin-protein ligase brl1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=brl1 PE=1 SV=1
10	AFDB:Q6LFN2	0.092	0.085	6.151E-5	1103	0.118	0.107	Q6LFN2.pdb.gz	ZNRF1_PLAF7 RING finger protein PFF0165c OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PFF0165c PE=1 SV=1
11	PDB:5dkaA	0.044	0.397	8.702E-2	96	0.014	0.146	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
12	PDB:5gm6a	0.043	0.310	1.258E-1	123	0.013	0.106	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
13	PDB:7dvq9	0.051	0.122	6.201E-1	409	0.009	0.022	7dvq9.pdb.gz	Structure of the activated human minor spliceosome.
14	PDB:6gym3	0.048	0.308	8.961E-1	138	0.014	0.101	6gym3.pdb.gz	Promoter Distortion and Opening in the RNA Polymerase II Cleft.
15	PDB:7d5sB2	0.059	0.068	1.145	851	0.011	0.013	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
16	PDB:7nvr3	0.049	0.212	1.557	214	0.016	0.075	7nvr3.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
17	PDB:7oikA	0.034	0.008	2.543	4426	0.011	0.002	7oikA.pdb.gz	E3 ubiquitin ligase RNF213 employs a non-canonical zinc finger active site and is allosterically regulated by ATP
18	PDB:6j6gc	0.068	0.134	3.251	436	0.047	0.108	6j6gc.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
19	PDB:2lgvA	0.032	0.274	3.457	100	0.009	0.090	2lgvA.pdb.gz	Selective recruitment of an e2~ubiquitin complex by an e3 ubiquitin ligase.
20	PDB:7n6g3I	0.079	0.180	4.155	401	0.054	0.135	7n6g3I.pdb.gz	Cryo-EM structure of an active central apparatus.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H3BP71	0.0	1917	961	0.960	1.000	H3BP71_HUMAN E3 ubiquitin protein ligase OS=Homo sapiens OX=9606 GN=RNF40 PE=1 SV=2
2	O75150	0.0	2016	1001	1.000	1.000	BRE1B_HUMAN E3 ubiquitin-protein ligase BRE1B OS=Homo sapiens OX=9606 GN=RNF40 PE=1 SV=5
3	Q3U319	0.0	1821	1001	0.925	0.925	BRE1B_MOUSE E3 ubiquitin-protein ligase BRE1B OS=Mus musculus OX=10090 GN=Rnf40 PE=1 SV=2
4	Q8CJB9	0.0	1850	1002	0.926	0.925	BRE1B_RAT E3 ubiquitin-protein ligase BRE1B OS=Rattus norvegicus OX=10116 GN=Rnf40 PE=1 SV=1
5	Q9VRP9	0.0	777	1044	0.462	0.443	BRE1_DROME E3 ubiquitin-protein ligase Bre1 OS=Drosophila melanogaster OX=7227 GN=Bre1 PE=1 SV=2
6	Q5VTR2	1.81e-164	510	975	0.266	0.273	BRE1A_HUMAN E3 ubiquitin-protein ligase BRE1A OS=Homo sapiens OX=9606 GN=RNF20 PE=1 SV=2
7	Q5DTM8	2.82e-164	509	973	0.266	0.273	BRE1A_MOUSE E3 ubiquitin-protein ligase BRE1A OS=Mus musculus OX=10090 GN=Rnf20 PE=1 SV=2
8	C9JXC9	2.56e-41	152	181	0.098	0.541	C9JXC9_HUMAN E3 ubiquitin protein ligase (Fragment) OS=Homo sapiens OX=9606 GN=RNF20 PE=1 SV=1
9	P34537	1.68e-40	163	837	0.115	0.137	BRE1_CAEEL E3 ubiquitin-protein ligase bre-1 OS=Caenorhabditis elegans OX=6239 GN=rfp-1 PE=1 SV=2
10	Q8RXD6	1.02e-32	139	878	0.112	0.128	BRE1A_ARATH E3 ubiquitin-protein ligase BRE1-like 1 OS=Arabidopsis thaliana OX=3702 GN=HUB1 PE=1 SV=1
11	Q9C895	2.43e-26	119	900	0.113	0.126	BRE1B_ARATH E3 ubiquitin-protein ligase BRE1-like 2 OS=Arabidopsis thaliana OX=3702 GN=HUB2 PE=1 SV=2
12	Q07457	7.58e-15	81.6	700	0.089	0.127	BRE1_YEAST E3 ubiquitin-protein ligase BRE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BRE1 PE=1 SV=1
13	O74563	3.45e-12	72.8	680	0.028	0.041	BRL2_SCHPO E3 ubiquitin-protein ligase brl2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=brl2 PE=1 SV=1
14	Q5A4X0	1.50e-10	67.8	681	0.023	0.034	BRE1_CANAL E3 ubiquitin-protein ligase BRE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BRE1 PE=3 SV=1
15	Q6LFN2	3.70e-09	63.5	1103	0.023	0.021	ZNRF1_PLAF7 RING finger protein PFF0165c OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PFF0165c PE=1 SV=1
16	Q1MTQ0	2.34e-07	57.4	692	0.064	0.092	BRL1_SCHPO E3 ubiquitin-protein ligase brl1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=brl1 PE=1 SV=1
17	Q9VNJ0	2.85e-07	55.8	319	0.033	0.103	Q9VNJ0_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=dgrn PE=1 SV=1
18	Q8I0J6	3.42e-07	55.5	312	0.033	0.106	Q8I0J6_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=dgrn PE=2 SV=1
19	A0A0B4LHT4	1.11e-06	52.8	205	0.033	0.161	A0A0B4LHT4_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=dgrn PE=4 SV=1
20	Q22257	0.002	45.1	1295	0.039	0.030	Q22257_CAEEL HoloCentric chromosome binding Protein OS=Caenorhabditis elegans OX=6239 GN=hcp-2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08647 BRE1	0.97	20.9	BRE1 E3 ubiquitin ligase
2	PF06160 EzrA	1.7	18.4	Septation ring formation regulator, EzrA
3	PF14662 KASH_CCD	1.6	20.1	Coiled-coil region of CCDC155 or KASH
4	PF14447 Prok-RING_4	2.3e+02	13.1	Prokaryotic RING finger family 4
5	PF00097 zf-C3HC4	0.031	25.5	Zinc finger, C3HC4 type (RING finger)
6	PF13923 zf-C3HC4_2	1.4	20.1	Zinc finger, C3HC4 type (RING finger)
7	PF13920 zf-C3HC4_3	0.0086	27.2	Zinc finger, C3HC4 type (RING finger)
8	PF12678 zf-rbx1	1.3e+02	14.2	RING-H2 zinc finger domain
9	PF13639 zf-RING_2	18	17.1	Ring finger domain
10	PF14634 zf-RING_5	23	16.4	zinc-RING finger domain
11	PF13445 zf-RING_UBOX	81	14.7	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000325677

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360613	0.999	Ubiquitin-conjugating enzyme E2 A
2	9606.ENSP00000265339	0.997	Ubiquitin-conjugating enzyme E2 B
3	9606.ENSP00000373772	0.991	E3 ubiquitin-protein ligase BRE1A
4	9606.ENSP00000299601	0.958	RNA polymerase-associated protein LEO1
5	9606.ENSP00000356405	0.948	Parafibromin
6	9606.ENSP00000316176	0.944	Ubiquitin-conjugating enzyme E2 N
7	9606.ENSP00000355013	0.917	RNA polymerase-associated protein CTR9 homolog
8	9606.ENSP00000358151	0.913	Histone H2B type 2-E
9	9606.ENSP00000221265	0.911	RNA polymerase II-associated factor 1 homolog
10	9606.ENSP00000340305	0.907	Ubiquitin-conjugating enzyme E2 variant 1
11	9606.ENSP00000346986	0.895	WW domain-containing adapter protein with coiled-coil
12	9606.ENSP00000360116	0.881	Ubiquitin-conjugating enzyme E2 U
13	9606.ENSP00000374280	0.855	RNA polymerase-associated protein RTF1 homolog
14	9606.ENSP00000371475	0.831	TP53-binding protein 1
15	9606.ENSP00000219548	0.792	E3 ubiquitin-protein ligase CHIP
16	9606.ENSP00000303709	0.774	Ubiquitin-conjugating enzyme E2 E1
17	9606.ENSP00000482674	0.769	Histone H2B type 1-B
18	9606.ENSP00000483903	0.769	Histone H2B type 1-N
19	9606.ENSP00000319104	0.768	Transcription elongation factor SPT6
20	9606.ENSP00000267973	0.759	WD repeat-containing protein 61

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0019899	0.997	enzyme binding
GO:0044390	0.895	ubiquitin-like protein conjugating enzyme binding
GO:0031624	0.885	ubiquitin conjugating enzyme binding
GO:0017075	0.647	syntaxin-1 binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008152	0.996	metabolic process
GO:0044238	0.992	primary metabolic process
GO:0043170	0.986	macromolecule metabolic process
GO:1901564	0.985	organonitrogen compound metabolic process
GO:0019538	0.983	protein metabolic process
GO:0016567	0.955	protein ubiquitination
GO:0016570	0.952	histone modification
GO:0016574	0.931	histone ubiquitination
GO:0009987	0.919	cellular process
GO:0050789	0.917	regulation of biological process
GO:0006513	0.891	protein monoubiquitination
GO:0044237	0.883	cellular metabolic process
GO:0060255	0.857	regulation of macromolecule metabolic process
GO:0048518	0.847	positive regulation of biological process
GO:0080090	0.846	regulation of primary metabolic process
GO:0051171	0.845	regulation of nitrogen compound metabolic process
GO:0050794	0.807	regulation of cellular process
GO:0010604	0.730	positive regulation of macromolecule metabolic process
GO:0051173	0.715	positive regulation of nitrogen compound metabolic process
GO:0044260	0.689	cellular macromolecule metabolic process
GO:0050896	0.682	response to stimulus
GO:0031323	0.472	regulation of cellular metabolic process
GO:0006508	0.469	proteolysis
GO:0048522	0.440	positive regulation of cellular process
GO:0031325	0.312	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.999	protein-containing complex
GO:0043232	0.994	intracellular non-membrane-bounded organelle
GO:0016020	0.984	membrane
GO:1902494	0.976	catalytic complex
GO:0005694	0.916	chromosome
GO:1990234	0.906	transferase complex
GO:0140535	0.897	intracellular protein-containing complex
GO:0000785	0.856	chromatin
GO:0005737	0.759	cytoplasm
GO:0000151	0.527	ubiquitin ligase complex
GO:0005829	0.503	cytosol
GO:0031371	0.428	ubiquitin conjugating enzyme complex
GO:0140513	0.339	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]