StarFunc result for job id O75151

User Input

>input (1096 residues)
MATVPVYCVCRLPYDVTRFMIECDACKDWFHGSCVGVEEEEAPDIDIYHCPNCEKTHGKS
TLKKKRTWHKHGPGQAPDVKPVQNGSQLFIKELRSRTFPSAEDVVARVPGSQLTLGYMEE
HGFTEPILVPKKDGLGLAVPAPTFYVSDVENYVGPERSVDVTDVTKQKDCKMKLKEFVDY
YYSTNRKRVLNVTNLEFSDTRMSSFVEPPDIVKKLSWVENYWPDDALLAKPKVTKYCLIC
VKDSYTDFHIDSGGASAWYHVLKGEKTFYLIRPASANISLYERWRSASNHSEMFFADQVD
KCYKCIVKQGQTLFIPSGWIYATLTPVDCLAFAGHFLHSLSVEMQMRAYEVERRLKLGSL
TQFPNFETACWYMGKHLLEAFKGSHKSGKQLPPHLVQGAKILNGAFRSWTKKQALAEHED
ELPEHFKPSQLIKDLAKEIRLSENASKAVRPEVNTVASSDEVCDGDREKEEPPSPIEATP
PQSLLEKVSKKKTPKTVKMPKPSKIPKPPKPPKPPRPPKTLKLKDGGKKKGKKSRESASP
TIPNLDLLEAHTKEALTKMEPPKKGKATKSVLSVPNKDVVHMQNDVERLEIREQTKSKSE
AKWKYKNSKPDSLLKMEEEQKLEKSPLAGNKDNKFSFSFSNKKLLGSKALRPPTSPGVFG
ALQNFKEDKPKPVRDEYEYVSDDGELKIDEFPIRRKKNAPKRDLSFLLDKKAVLPTPVTK
PKLDSAAYKSDDSSDEGSLHIDTDTKPGRNARVKKESGSSAAGILDLLQASEEVGALEYN
PSSQPPASPSTQEAIQGMLSMANLQASDSCLQTTWGAGQAKGSSLAAHGARKNGGGSGKS
AGKRLLKRAAKNSVDLDDYEEEQDHLDACFKDSDYVYPSLESDEDNPIFKSRSKKRKGSD
DAPYSPTARVGPSVPRQDRPVREGTRVASIETGLAAAAAKLSQQEEQKSKKKKSAKRKLT
PNTTSPSTSTSISAGTTSTSTTPASTTPASTTPASTSTASSQASQEGSSPEPPPESHSSS
LADHEYTAAGTFTGAQAGRTSQPMAPGVFLTQRRPSASSPNNNTAAKGKRTKKGMATAKQ
RLGKILKIHRNGKLLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75151	0.999	0.999	0.000	1096	1.000	1.000	O75151.pdb.gz	PHF2_HUMAN Lysine-specific demethylase PHF2 OS=Homo sapiens OX=9606 GN=PHF2 PE=1 SV=4
2	AFDB:Q9UPP1	0.357	0.369	8.021E-87	1060	0.483	0.499	Q9UPP1.pdb.gz	PHF8_HUMAN Histone lysine demethylase PHF8 OS=Homo sapiens OX=9606 GN=PHF8 PE=1 SV=3
3	AFDB:Q6ZMT4	0.402	0.465	8.225E-71	941	0.341	0.397	Q6ZMT4.pdb.gz	KDM7A_HUMAN Lysine-specific demethylase 7A OS=Homo sapiens OX=9606 GN=KDM7A PE=1 SV=2
4	AFDB:Q5RHD1	0.399	0.496	2.429E-63	875	0.295	0.369	Q5RHD1.pdb.gz	KDM7A_DANRE Lysine-specific demethylase 7A OS=Danio rerio OX=7955 GN=kdm7a PE=2 SV=2
5	PDB:3al5B	0.171	0.525	6.168E-10	311	0.039	0.138	3al5B.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
6	AFDB:F1QPD2	0.163	0.125	4.732E-9	1482	0.120	0.088	F1QPD2.pdb.gz
7	PDB:4b7eA	0.156	0.432	1.255E-8	349	0.047	0.149	4b7eA.pdb.gz	Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
8	PDB:5nfnB	0.166	0.493	1.255E-8	318	0.043	0.148	5nfnB.pdb.gz	(3S)-Lysyl hydroxylation of TRAFAC GTPases is catalyzed by the human Jumonji-C oxygenase JMJD7.
9	PDB:4qszA	0.165	0.251	2.292E-8	686	0.044	0.070	4qszA.pdb.gz	Crystal structure of mouse JMJd7 fused with maltose-binding protein
10	PDB:7yxgA	0.163	0.493	2.421E-8	313	0.045	0.157	7yxgA.pdb.gz	Conservation of the unusual dimeric JmjC fold of JMJD7 from Drosophila melanogaster to humans.
11	PDB:3al5C	0.159	0.517	3.753E-8	284	0.037	0.144	3al5C.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
12	PDB:4cclB	0.143	0.367	6.831E-6	372	0.033	0.097	4cclB.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
13	PDB:4bxfA	0.134	0.314	2.280E-5	425	0.034	0.087	4bxfA.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
14	PDB:4bu2A	0.080	0.207	3.732E-5	379	0.029	0.084	4bu2A.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
15	PDB:2vqaA	0.059	0.166	1.828E-4	356	0.016	0.051	2vqaA.pdb.gz	Protein-Folding Location Can Regulate Manganese-Binding Versus Copper- or Zinc-Binding.
16	AFDB:Q2L6I0	0.046	0.052	2.853E-2	940	0.113	0.132	Q2L6I0.pdb.gz	Q2L6I0_HUMAN Serine/threonine-protein phosphatase 1 regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PPP1R10 PE=2 SV=1
17	AFDB:A2A690	0.058	0.037	5.505E-2	1994	0.101	0.056	A2A690.pdb.gz	TANC2_MOUSE Protein TANC2 OS=Mus musculus OX=10090 GN=Tanc2 PE=1 SV=1
18	AFDB:O43683	0.046	0.047	8.533E-2	1085	0.091	0.092	O43683.pdb.gz	BUB1_HUMAN Mitotic checkpoint serine/threonine-protein kinase BUB1 OS=Homo sapiens OX=9606 GN=BUB1 PE=1 SV=1
19	AFDB:Q9W002	0.053	0.041	1.006E-1	1504	0.117	0.085	Q9W002.pdb.gz	Q9W002_DROME Misshapen, isoform A OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=3
20	AFDB:Q9UPX6	0.041	0.047	1.062E-1	916	0.109	0.131	Q9UPX6.pdb.gz	MNAR1_HUMAN Major intrinsically disordered Notch2-binding receptor 1 OS=Homo sapiens OX=9606 GN=MINAR1 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0Y3N9	0.0	649	1049	0.258	0.270	H0Y3N9_HUMAN PHD finger protein 8 OS=Homo sapiens OX=9606 GN=PHF8 PE=1 SV=2
2	O75151	0.0	2258	1096	1.000	1.000	PHF2_HUMAN Lysine-specific demethylase PHF2 OS=Homo sapiens OX=9606 GN=PHF2 PE=1 SV=4
3	P0CF52	0.0	569	577	0.234	0.444	KDM7B_DANRE Lysine-specific demethylase 7B OS=Danio rerio OX=7955 GN=jhdm1db PE=2 SV=1
4	P0CH95	0.0	862	1032	0.469	0.498	PHF8_DANRE Histone lysine demethylase PHF8 OS=Danio rerio OX=7955 GN=phf8 PE=1 SV=1
5	Q3UWM4	0.0	595	940	0.254	0.296	KDM7A_MOUSE Lysine-specific demethylase 7A OS=Mus musculus OX=10090 GN=Kdm7a PE=1 SV=2
6	Q5RHD1	0.0	553	875	0.227	0.285	KDM7A_DANRE Lysine-specific demethylase 7A OS=Danio rerio OX=7955 GN=kdm7a PE=2 SV=2
7	Q6ZMT4	0.0	603	941	0.312	0.363	KDM7A_HUMAN Lysine-specific demethylase 7A OS=Homo sapiens OX=9606 GN=KDM7A PE=1 SV=2
8	Q9UPP1	0.0	651	1060	0.258	0.267	PHF8_HUMAN Histone lysine demethylase PHF8 OS=Homo sapiens OX=9606 GN=PHF8 PE=1 SV=3
9	Q9WTU0	0.0	1942	1096	0.935	0.935	PHF2_MOUSE Lysine-specific demethylase PHF2 OS=Mus musculus OX=10090 GN=Phf2 PE=1 SV=2
10	H0Y589	7.24e-95	318	659	0.123	0.205	H0Y589_HUMAN PHD finger protein 8 (Fragment) OS=Homo sapiens OX=9606 GN=PHF8 PE=1 SV=1
11	Q9VHH9	1.03e-72	266	1345	0.119	0.097	JHD1_DROME JmjC domain-containing histone demethylation protein 1 OS=Drosophila melanogaster OX=7227 GN=Kdm2 PE=1 SV=2
12	Q8NHM5	2.08e-71	263	1336	0.112	0.092	KDM2B_HUMAN Lysine-specific demethylase 2B OS=Homo sapiens OX=9606 GN=KDM2B PE=1 SV=1
13	F6P9Q3	3.07e-71	262	1260	0.111	0.097	F6P9Q3_DANRE Lysine (K)-specific demethylase 2Bb OS=Danio rerio OX=7955 GN=LOC100536129 PE=4 SV=1
14	Q6P1G2	5.34e-71	261	1309	0.112	0.094	KDM2B_MOUSE Lysine-specific demethylase 2B OS=Mus musculus OX=10090 GN=Kdm2b PE=1 SV=1
15	P59997	1.54e-67	250	1161	0.107	0.101	KDM2A_MOUSE Lysine-specific demethylase 2A OS=Mus musculus OX=10090 GN=Kdm2a PE=1 SV=2
16	A0A0R4IH56	1.88e-67	250	1295	0.110	0.093	A0A0R4IH56_DANRE Lysine (K)-specific demethylase 2Aa OS=Danio rerio OX=7955 GN=jhdm1A-b PE=1 SV=1
17	I3VM53	3.51e-67	249	1162	0.106	0.100	I3VM53_HUMAN F-box and leucine-rich repeat protein 11, isoform CRA_a OS=Homo sapiens OX=9606 GN=KDM2A PE=2 SV=1
18	Q9Y2K7	3.51e-67	249	1162	0.106	0.100	KDM2A_HUMAN Lysine-specific demethylase 2A OS=Homo sapiens OX=9606 GN=KDM2A PE=1 SV=3
19	I3VM54	3.98e-67	248	1145	0.106	0.101	I3VM54_HUMAN Lysine demethylase 2A OS=Homo sapiens OX=9606 GN=KDM2A PE=1 SV=1
20	Q9GYI0	4.08e-62	231	910	0.130	0.157	KDM7_CAEEL Lysine-specific demethylase 7 homolog OS=Caenorhabditis elegans OX=6239 GN=jmjd-1.2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13621 Cupin_8	0.0013	30.2	Cupin-like domain
2	PF17811 JHD	3.3e-34	128.8	Jumonji helical domain
3	PF02373 JmjC	3.9e-09	48.3	JmjC domain, hydroxylase
4	PF00628 PHD	3.3e-05	35.0	PHD-finger
5	PF13831 PHD_2	2.2e+02	12.7	PHD-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000352185

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000279873	0.990	AT-rich interactive domain-containing protein 5B
2	9606.ENSP00000476960	0.910	Histone cluster 2 H3 pseudogene 2
3	9606.ENSP00000419004	0.893	60S ribosomal export protein NMD3
4	9606.ENSP00000333277	0.885	Histone cluster 2 H3 family member d
5	9606.ENSP00000355657	0.885	Histone H3.1t
6	9606.ENSP00000355778	0.856	Histone H3.3
7	9606.ENSP00000385479	0.854	Histone H3.2
8	9606.ENSP00000254810	0.851	H3 histone, family 3B (H3.3B)
9	9606.ENSP00000339835	0.849	Histone H3.3C
10	9606.ENSP00000352252	0.849	Histone cluster 1 H3 family member j
11	9606.ENSP00000358154	0.849	Histone cluster 2 H3 family member c
12	9606.ENSP00000358160	0.849	Histone cluster 1 H3 family member h
13	9606.ENSP00000366999	0.849	Histone cluster 1 H3 family member d
14	9606.ENSP00000480826	0.849	Histone cluster 1 H3 family member a
15	9606.ENSP00000482271	0.849	Histone cluster 1 H3 family member e
16	9606.ENSP00000483283	0.849	Histone cluster 1 H3 family member i
17	9606.ENSP00000484095	0.849	Histone cluster 1 H3 family member f
18	9606.ENSP00000484638	0.849	Histone cluster 1 H3 family member g
19	9606.ENSP00000484658	0.849	Histone cluster 1 H3 family member c
20	9606.ENSP00000484841	0.849	Histone H3.1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0032454	0.999	histone H3K9 demethylase activity
GO:0035064	0.998	methylated histone binding
GO:0003712	0.997	transcription coregulator activity
GO:0008270	0.996	zinc ion binding
GO:0005506	0.994	iron ion binding
GO:0016706	0.969	2-oxoglutarate-dependent dioxygenase activity
GO:0003713	0.965	transcription coactivator activity
GO:0097159	0.694	organic cyclic compound binding
GO:1901363	0.693	heterocyclic compound binding
GO:0003682	0.590	chromatin binding
GO:0003676	0.532	nucleic acid binding
GO:0071558	0.383	histone H3K27me2/H3K27me3 demethylase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0050794	0.986	regulation of cellular process
GO:0010468	0.986	regulation of gene expression
GO:0048518	0.977	positive regulation of biological process
GO:0009987	0.940	cellular process
GO:0010604	0.934	positive regulation of macromolecule metabolic process
GO:0048519	0.888	negative regulation of biological process
GO:0071704	0.886	organic substance metabolic process
GO:0043170	0.858	macromolecule metabolic process
GO:0044238	0.845	primary metabolic process
GO:0006807	0.835	nitrogen compound metabolic process
GO:0043412	0.833	macromolecule modification
GO:0036211	0.817	protein modification process
GO:0048523	0.800	negative regulation of cellular process
GO:0051171	0.788	regulation of nitrogen compound metabolic process
GO:0080090	0.787	regulation of primary metabolic process
GO:0031323	0.772	regulation of cellular metabolic process
GO:0019219	0.738	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.607	regulation of cellular biosynthetic process
GO:0048522	0.604	positive regulation of cellular process
GO:0010556	0.592	regulation of macromolecule biosynthetic process
GO:0051252	0.592	regulation of RNA metabolic process
GO:0010628	0.565	positive regulation of gene expression
GO:0071840	0.561	cellular component organization or biogenesis
GO:0006325	0.540	chromatin organization
GO:2001141	0.523	regulation of RNA biosynthetic process
GO:0006355	0.507	regulation of DNA-templated transcription
GO:0006338	0.454	chromatin remodeling
GO:0032501	0.443	multicellular organismal process
GO:0051173	0.402	positive regulation of nitrogen compound metabolic process
GO:0031325	0.395	positive regulation of cellular metabolic process
GO:0032502	0.367	developmental process
GO:0048856	0.362	anatomical structure development
GO:0007275	0.354	multicellular organism development
GO:0045935	0.310	positive regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005694	0.981	chromosome
GO:0005730	0.974	nucleolus
GO:0098687	0.874	chromosomal region
GO:0000793	0.731	condensed chromosome
GO:0000775	0.729	chromosome, centromeric region
GO:0099080	0.685	supramolecular complex
GO:0000779	0.603	condensed chromosome, centromeric region
GO:0000776	0.588	kinetochore
GO:0000785	0.426	chromatin
GO:0032991	0.417	protein-containing complex
GO:0016020	0.319	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.11.-	0.969	With 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors.
RHEA:60224	0.383	2 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(27)-[histone H3] + 2 O2 = 2 CO2 + 2 formaldehyde + N(6)-methyl-L-lysyl(27)-[histone H3] + 2 succinate
EC:1.14.11.68	0.383	[histone H3]-trimethyl-L-lysine(27) demethylase.

[back to server]