StarFunc result for job id O75153

User Input

>input (1309 residues)
MLLNGDCPESLKKEAAAAEPPRENGLDEAGPGDETTGQEVIVIQDTGFSVKILAPGIEPF
SLQVSPQEMVQEIHQVLMDREDTCHRTCFSLHLDGNVLDHFSELRSVEGLQEGSVLRVVE
EPYTVREARIHVRHVRDLLKSLDPSDAFNGVDCNSLSFLSVFTDGDLGDSGKRKKGLEMD
PIDCTPPEYILPGSRERPLCPLQPQNRDWKPLQCLKVLTMSGWNPPPGNRKMHGDLMYLF
VITAEDRQVSITASTRGFYLNQSTAYHFNPKPASPRFLSHSLVELLNQISPTFKKNFAVL
QKKRVQRHPFERIATPFQVYSWTAPQAEHAMDCVRAEDAYTSRLGYEEHIPGQTRDWNEE
LQTTRELPRKNLPERLLRERAIFKVHSDFTAAATRGAMAVIDGNVMAINPSEETKMQMFI
WNNIFFSLGFDVRDHYKDFGGDVAAYVAPTNDLNGVRTYNAVDVEGLYTLGTVVVDYRGY
RVTAQSIIPGILERDQEQSVIYGSIDFGKTVVSHPRYLELLERTSRPLKILRHQVLNDRD
EEVELCSSVECKGIIGNDGRHYILDLLRTFPPDLNFLPVPGEELPEECARAGFPRAHRHK
LCCLRQELVDAFVEHRYLLFMKLAALQLMQQNASQLETPSSLENGGPSSLESKSEDPPGQ
EAGSEEEGSSASGLAKVKELAETIAADDGTDPRSREVIRNACKAVGSISSTAFDIRFNPD
IFSPGVRFPESCQDEVRDQKQLLKDAAAFLLSCQIPGLVKDCMEHAVLPVDGATLAEVMR
QRGINMRYLGKVLELVLRSPARHQLDHVFKIGIGELITRSAKHIFKTYLQGVELSGLSAA
ISHFLNCFLSSYPNPVAHLPADELVSKKRNKRRKNRPPGAADNTAWAVMTPQELWKNICQ
EAKNYFDFDLECETVDQAVETYGLQKITLLREISLKTGIQVLLKEYSFDSRHKPAFTEED
VLNIFPVVKHVNPKASDAFHFFQSGQAKVQQGFLKEGCELINEALNLFNNVYGAMHVETC
ACLRLLARLHYIMGDYAEALSNQQKAVLMSERVMGTEHPNTIQEYMHLALYCFASSQLST
ALSLLYRARYLMLLVFGEDHPEMALLDNNIGLVLHGVMEYDLSLRFLENALAVSTKYHGP
KALKVALSHHLVARVYESKAEFRSALQHEKEGYTIYKTQLGEDHEKTKESSEYLKCLTQQ
AVALQRTMNEIYRNGSSANIPPLKFTAPSMASVLEQLNVINGILFIPLSQKDLENLKAEV
ARRHQLQEASRNRDRAEEPMATEPAPAGAPGDLGSQPPAAKDPSPSVQG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A1ZAB5	0.898	0.814	0.000	1448	0.552	0.499	A1ZAB5.pdb.gz	CLU_DROME Protein clueless OS=Drosophila melanogaster OX=7227 GN=clu PE=1 SV=1
2	AFDB:O75153	1.000	1.000	0.000	1309	1.000	1.000	O75153.pdb.gz	CLU_HUMAN Clustered mitochondria protein homolog OS=Homo sapiens OX=9606 GN=CLUH PE=1 SV=2
3	AFDB:O15818	0.717	0.711	6.246E-75	1320	0.291	0.289	O15818.pdb.gz	CLU_DICDI Clustered mitochondria protein homolog OS=Dictyostelium discoideum OX=44689 GN=clua PE=1 SV=2
4	AFDB:F4J5S1	0.731	0.682	2.269E-72	1407	0.288	0.268	F4J5S1.pdb.gz	CLU_ARATH Clustered mitochondria protein OS=Arabidopsis thaliana OX=3702 GN=FMT PE=2 SV=1
5	AFDB:Q03690	0.681	0.697	2.547E-55	1277	0.207	0.212	Q03690.pdb.gz	CLU_YEAST Clustered mitochondria protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CLU1 PE=1 SV=1
6	AFDB:F4HZK4	0.524	0.437	3.565E-42	1608	0.189	0.154	F4HZK4.pdb.gz	REC3_ARATH Protein REDUCED CHLOROPLAST COVERAGE 3 OS=Arabidopsis thaliana OX=3702 GN=REC3 PE=3 SV=1
7	AFDB:F4HS99	0.525	0.395	4.030E-41	1797	0.204	0.149	F4HS99.pdb.gz	REC1_ARATH Protein REDUCED CHLOROPLAST COVERAGE 1 OS=Arabidopsis thaliana OX=3702 GN=REC1 PE=1 SV=1
8	AFDB:F4JKH6	0.521	0.388	1.195E-40	1819	0.204	0.147	F4JKH6.pdb.gz	REC2_ARATH Protein REDUCED CHLOROPLAST COVERAGE 2 OS=Arabidopsis thaliana OX=3702 GN=REC2 PE=1 SV=1
9	AFDB:Q75JJ2	0.293	0.269	1.576E-21	1445	0.138	0.125	Q75JJ2.pdb.gz	Q75JJ2_DICDI Clu domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0276091 PE=4 SV=1
10	AFDB:Q54XJ7	0.294	0.293	1.857E-20	1313	0.108	0.107	Q54XJ7.pdb.gz	Q54XJ7_DICDI SH2 domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0278895 PE=4 SV=1
11	PDB:7qe7J	0.127	0.310	8.230E-5	510	0.051	0.131	7qe7J.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
12	PDB:7qe7K	0.142	0.322	8.205E-4	531	0.053	0.130	7qe7K.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
13	PDB:4gyoB	0.141	0.458	1.054E-3	359	0.028	0.103	4gyoB.pdb.gz	Conformational change-induced repeat domain expansion regulates rap phosphatase quorum-sensing signal receptors.
14	PDB:7kw7E	0.087	0.319	1.195E-3	327	0.025	0.101	7kw7E.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:4i9eA	0.128	0.402	1.536E-3	383	0.039	0.133	4i9eA.pdb.gz	Structural basis of Rap phosphatase inhibition by Phr peptides
16	PDB:8a3tJ	0.140	0.336	1.670E-3	509	0.053	0.136	8a3tJ.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
17	PDB:7ntfA	0.138	0.191	2.058E-3	918	0.053	0.075	7ntfA.pdb.gz
18	PDB:5dseA	0.110	0.218	2.238E-3	537	0.056	0.136	5dseA.pdb.gz
19	PDB:7dkhI	0.066	0.085	2.537E-3	914	0.066	0.094	7dkhI.pdb.gz
20	PDB:6tedQ	0.104	0.141	3.400E-3	890	0.063	0.093	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1ZAB5	0.0	1492	1448	0.552	0.499	CLU_DROME Protein clueless OS=Drosophila melanogaster OX=7227 GN=clu PE=1 SV=1
2	O75153	0.0	2722	1309	1.000	1.000	CLU_HUMAN Clustered mitochondria protein homolog OS=Homo sapiens OX=9606 GN=CLUH PE=1 SV=2
3	O15818	4.13e-174	554	1320	0.264	0.262	CLU_DICDI Clustered mitochondria protein homolog OS=Dictyostelium discoideum OX=44689 GN=clua PE=1 SV=2
4	F4J5S1	4.01e-170	546	1407	0.281	0.262	CLU_ARATH Clustered mitochondria protein OS=Arabidopsis thaliana OX=3702 GN=FMT PE=2 SV=1
5	F4J5R9	1.35e-166	536	1419	0.281	0.259	F4J5R9_ARATH Clustered mitochondria protein homolog OS=Arabidopsis thaliana OX=3702 GN=NOXY38 PE=1 SV=1
6	F4JKH6	2.65e-46	185	1819	0.099	0.071	REC2_ARATH Protein REDUCED CHLOROPLAST COVERAGE 2 OS=Arabidopsis thaliana OX=3702 GN=REC2 PE=1 SV=1
7	F4HS99	1.97e-43	176	1797	0.107	0.078	REC1_ARATH Protein REDUCED CHLOROPLAST COVERAGE 1 OS=Arabidopsis thaliana OX=3702 GN=REC1 PE=1 SV=1
8	F4HZK4	3.12e-41	169	1608	0.117	0.095	REC3_ARATH Protein REDUCED CHLOROPLAST COVERAGE 3 OS=Arabidopsis thaliana OX=3702 GN=REC3 PE=3 SV=1
9	Q03690	1.01e-40	166	1277	0.122	0.125	CLU_YEAST Clustered mitochondria protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CLU1 PE=1 SV=1
10	Q54XJ7	1.10e-13	79.0	1313	0.049	0.049	Q54XJ7_DICDI SH2 domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0278895 PE=4 SV=1
11	Q54T92	1.01e-11	72.4	2107	0.044	0.027	Q54T92_DICDI Rab GTPase domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=comB PE=4 SV=1
12	Q75JJ2	3.90e-11	70.5	1445	0.046	0.042	Q75JJ2_DICDI Clu domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0276091 PE=4 SV=1
13	Q96NS8	8.58e-10	60.8	147	0.031	0.272	CLUP3_HUMAN Putative protein CLUHP3 OS=Homo sapiens OX=9606 GN=CLUHP3 PE=5 SV=1
14	Q7TNH6	2.36e-09	64.7	1325	0.055	0.054	NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus OX=10090 GN=Nphp3 PE=1 SV=2
15	Q8CD76	7.11e-09	62.4	616	0.037	0.080	Q8CD76_MOUSE Kinesin light chain OS=Mus musculus OX=10090 GN=Klc1 PE=1 SV=1
16	P46822	1.14e-08	61.6	540	0.047	0.113	KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans OX=6239 GN=klc-2 PE=1 SV=2
17	Q7Z494	1.29e-08	62.0	1330	0.046	0.045	NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens OX=9606 GN=NPHP3 PE=1 SV=1
18	Q07866	1.33e-08	61.6	573	0.037	0.086	KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1 PE=1 SV=2
19	P37285	2.29e-08	60.8	560	0.037	0.087	KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus OX=10116 GN=Klc1 PE=1 SV=2
20	Q9NSK0	2.20e-07	57.8	619	0.037	0.079	KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens OX=9606 GN=KLC4 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12895 ANAPC3	6.5e+02	12.0	Anaphase-promoting complex, cyclosome, subunit 3
2	PF13236 CLU	7.7e-80	279.5	Clustered mitochondria
3	PF15044 CLU_N	9.2e-13	59.7	Mitochondrial function, CLU-N-term
4	PF12807 eIF3_p135	1.5e-51	186.3	Translation initiation factor eIF3 subunit 135
5	PF05303 GSKIP_dom	35	15.9	GSKIP domain
6	PF13374 TPR_10	3.8e-07	41.0	Tetratricopeptide repeat
7	PF13424 TPR_12	2.2e-20	84.0	Tetratricopeptide repeat
8	PF07719 TPR_2	1.5e+02	13.9	Tetratricopeptide repeat
9	PF17874 TPR_MalT	0.00063	30.8	MalT-like TPR region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000458986

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000253108	0.730	Eukaryotic translation initiation factor 3 subunit G
2	9606.ENSP00000375836	0.707	Vigilin
3	9606.ENSP00000263092	0.701	U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase
4	9606.ENSP00000403902	0.683	RelA-associated inhibitor
5	9606.ENSP00000358140	0.680	Eukaryotic translation initiation factor 3 subunit A
6	9606.ENSP00000419038	0.673	Elongation factor G, mitochondrial
7	9606.ENSP00000280346	0.671	Dihydrolipoamide S-acetyltransferase
8	9606.ENSP00000354125	0.666	Eukaryotic translation initiation factor 3 subunit B
9	9606.ENSP00000245206	0.633	Aspartate aminotransferase, mitochondrial
10	9606.ENSP00000332604	0.618	Eukaryotic translation initiation factor 3 subunit C
11	9606.ENSP00000370258	0.605	Eukaryotic translation initiation factor 3 subunit C-like protein
12	9606.ENSP00000246957	0.561	Heat shock protein 75 kDa, mitochondrial
13	9606.ENSP00000315130	0.547	Clusterin
14	9606.ENSP00000322439	0.544	Elongation factor Tu, mitochondrial
15	9606.ENSP00000384867	0.535	Uncharacterized protein C6orf203
16	9606.ENSP00000357320	0.529	28S ribosomal protein S29, mitochondrial
17	9606.ENSP00000268989	0.523	Small G protein signaling modulator 2
18	9606.ENSP00000391723	0.522	Pumilio homolog 1
19	9606.ENSP00000216190	0.521	Eukaryotic translation initiation factor 3 subunit D
20	9606.ENSP00000346255	0.512	Protein phosphatase which positively regulates biosynthesis of the ubiquinone, coenzyme Q . Dephosphorylates the ubiquinone biosynthesis protein COQ7 which is likely to lead to its activation

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003729	1.000	mRNA binding
GO:0005515	0.750	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0007005	0.976	mitochondrion organization
GO:0048311	0.948	mitochondrion distribution
GO:0008152	0.434	metabolic process
GO:0071704	0.401	organic substance metabolic process
GO:0044238	0.346	primary metabolic process
GO:0050789	0.337	regulation of biological process
GO:0050794	0.315	regulation of cellular process
GO:0044237	0.305	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043229	0.893	intracellular organelle
GO:0043231	0.869	intracellular membrane-bounded organelle
GO:0016020	0.667	membrane
GO:0005739	0.597	mitochondrion
GO:0005829	0.502	cytosol
GO:0070013	0.420	intracellular organelle lumen
GO:0031090	0.407	organelle membrane
GO:0031966	0.398	mitochondrial membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]