StarFunc result for job id O75154

User Input

>input (756 residues)
MASAPPASPPGSEPPGPDPEPGGPDGPGAAQLAPGPAELRLGAPVGGPDPQSPGLDEPAP
GAAADGGARWSAGPAPGLEGGPRDPGPSAPPPRSGPRGQLASPDAPGPGPRSEAPLPELD
PLFSWTEEPEECGPASCPESAPFRLQGSSSSHRARGEVDVFSPFPAPTAGELALEQGPGS
PPQPSDLSQTHPLPSEPVGSQEDGPRLRAVFDALDGDGDGFVRIEDFIQFATVYGAEQVK
DLTKYLDPSGLGVISFEDFYQGITAIRNGDPDGQCYGGVASAQDEEPLACPDEFDDFVTY
EANEVTDSAYMGSESTYSECETFTDEDTSTLVHPELQPEGDADSAGGSAVPSECLDAMEE
PDHGALLLLPGRPHPHGQSVITVIGGEEHFEDYGEGSEAELSPETLCNGQLGCSDPAFLT
PSPTKRLSSKKVARYLHQSGALTMEALEDPSPELMEGPEEDIADKVVFLERRVLELEKDT
AATGEQHSRLRQENLQLVHRANALEEQLKEQELRACEMVLEETRRQKELLCKMEREKSIE
IENLQTRLQQLDEENSELRSCTPCLKANIERLEEEKQKLLDEIESLTLRLSEEQENKRRM
GDRLSHERHQFQRDKEATQELIEDLRKQLEHLQLLKLEAEQRRGRSSSMGLQEYHSRARE
SELEQEVRRLKQDNRNLKEQNEELNGQIITLSIQGAKSLFSTAFSESLAAEISSVSRDEL
MEAIQKQEEINFRLQDYIDRIIVAIMETNPSILEVK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75154	1.000	1.000	3.604E-103	756	1.000	1.000	O75154.pdb.gz	RFIP3_HUMAN Rab11 family-interacting protein 3 OS=Homo sapiens OX=9606 GN=RAB11FIP3 PE=1 SV=1
2	AFDB:Q8CHD8	0.417	0.317	1.288E-69	1047	0.714	0.516	Q8CHD8.pdb.gz	RFIP3_MOUSE Rab11 family-interacting protein 3 OS=Mus musculus OX=10090 GN=Rab11fip3 PE=1 SV=2
3	AFDB:J3KSW8	0.102	0.092	5.989E-7	844	0.177	0.159	J3KSW8.pdb.gz	J3KSW8_HUMAN Myosin phosphatase Rho interacting protein (Fragment) OS=Homo sapiens OX=9606 GN=MPRIP PE=1 SV=1
4	AFDB:Q9PTD7	0.096	0.055	7.460E-6	1360	0.179	0.099	Q9PTD7.pdb.gz	CING_XENLA Cingulin OS=Xenopus laevis OX=8355 GN=cgn PE=1 SV=3
5	AFDB:Q96R06	0.139	0.098	7.972E-6	1193	0.173	0.110	Q96R06.pdb.gz	SPAG5_HUMAN Sperm-associated antigen 5 OS=Homo sapiens OX=9606 GN=SPAG5 PE=1 SV=2
6	AFDB:A0A1C3NSL9	0.094	0.048	9.728E-6	1644	0.168	0.077	A0A1C3NSL9.pdb.gz	AJM1_CAEEL Apical junction molecule OS=Caenorhabditis elegans OX=6239 GN=ajm-1 PE=1 SV=1
7	AFDB:Q7TME2	0.111	0.081	1.889E-5	1165	0.163	0.106	Q7TME2.pdb.gz	SPAG5_MOUSE Sperm-associated antigen 5 OS=Mus musculus OX=10090 GN=Spag5 PE=1 SV=1
8	AFDB:A0A024R370	0.126	0.089	2.019E-5	1093	0.171	0.118	A0A024R370.pdb.gz
9	AFDB:Q9UPV0	0.128	0.081	4.785E-5	1460	0.184	0.095	Q9UPV0.pdb.gz	CE164_HUMAN Centrosomal protein of 164 kDa OS=Homo sapiens OX=9606 GN=CEP164 PE=1 SV=3
10	AFDB:Q5DU05	0.186	0.104	9.292E-5	1446	0.179	0.093	Q5DU05.pdb.gz	CE164_MOUSE Centrosomal protein of 164 kDa OS=Mus musculus OX=10090 GN=Cep164 PE=1 SV=2
11	PDB:5d43A	0.083	0.358	1.520E-3	150	0.024	0.120	5d43A.pdb.gz	Crystal Structure of Wild-Type Centrin 1 from Mus musculus Occupied by Ca2.
12	PDB:2ggmA	0.083	0.369	2.585E-3	149	0.024	0.121	2ggmA.pdb.gz	The structure of the human centrin 2-xeroderma pigmentosum group C protein complex.
13	PDB:1a2xA	0.084	0.336	3.372E-3	158	0.024	0.114	1a2xA.pdb.gz	Crystal structure of troponin C in complex with troponin I fragment at 2.3-A resolution.
14	PDB:1ggzA	0.086	0.385	4.114E-3	144	0.024	0.125	1ggzA.pdb.gz	Crystal structure of human calmodulin-like protein: insights into its functional role.
15	PDB:4oy4A	0.085	0.181	4.698E-3	335	0.020	0.045	4oy4A.pdb.gz
16	PDB:3qrxA	0.087	0.400	6.548E-3	145	0.029	0.152	3qrxA.pdb.gz	The structure, molecular dynamics, and energetics of centrin-melittin complex.
17	PDB:1osaA	0.085	0.372	8.539E-3	148	0.021	0.108	1osaA.pdb.gz	Structure of the recombinant Paramecium tetraurelia calmodulin at 1.68 A resolution.
18	PDB:1jfkA	0.082	0.397	1.042E-2	134	0.024	0.134	1jfkA.pdb.gz	NMR derived solution structure of an EF-hand calcium-binding protein from Entamoeba Histolytica.
19	PDB:1hqvA	0.079	0.294	1.190E-2	178	0.022	0.096	1hqvA.pdb.gz	Structure of apoptosis-linked protein ALG-2: insights into Ca2+-induced changes in penta-EF-hand proteins.
20	PDB:1s1eA	0.081	0.316	1.190E-2	181	0.017	0.072	1s1eA.pdb.gz	Two N-terminal domains of Kv4 K(+) channels regulate binding to and modulation by KChIP1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZQX0	0.0	988	1065	0.681	0.484	A0A8I5ZQX0_RAT RAB11 family interacting protein 3 OS=Rattus norvegicus OX=10116 GN=Rab11fip3 PE=4 SV=1
2	A0A8I5ZUA1	0.0	958	1053	0.668	0.480	A0A8I5ZUA1_RAT RAB11 family interacting protein 3 OS=Rattus norvegicus OX=10116 GN=Rab11fip3 PE=4 SV=1
3	A0A8I6GLH8	0.0	966	1110	0.681	0.464	A0A8I6GLH8_RAT RAB11 family interacting protein 3 OS=Rattus norvegicus OX=10116 GN=Rab11fip3 PE=4 SV=1
4	F7F3L0	0.0	773	491	0.534	0.823	F7F3L0_RAT RAB11 family interacting protein 3 OS=Rattus norvegicus OX=10116 GN=Nme4 PE=1 SV=1
5	O75154	0.0	1513	756	1.000	1.000	RFIP3_HUMAN Rab11 family-interacting protein 3 OS=Homo sapiens OX=9606 GN=RAB11FIP3 PE=1 SV=1
6	Q8CHD8	0.0	968	1047	0.676	0.488	RFIP3_MOUSE Rab11 family-interacting protein 3 OS=Mus musculus OX=10090 GN=Rab11fip3 PE=1 SV=2
7	X6RFI8	0.0	1256	677	0.836	0.934	X6RFI8_HUMAN RAB11 family interacting protein 3 OS=Homo sapiens OX=9606 GN=RAB11FIP3 PE=1 SV=1
8	Q3LGD4	5.23e-122	381	621	0.323	0.393	RFP4A_DANRE Rab11 family-interacting protein 4A OS=Danio rerio OX=7955 GN=rab11fip4a PE=2 SV=1
9	Q86YS3	5.24e-117	368	637	0.325	0.386	RFIP4_HUMAN Rab11 family-interacting protein 4 OS=Homo sapiens OX=9606 GN=RAB11FIP4 PE=1 SV=1
10	Q9VUD7	3.38e-20	97.1	502	0.142	0.213	Q9VUD7_DROME FI18160p1 OS=Drosophila melanogaster OX=7227 GN=nuf PE=2 SV=1
11	O61495	3.45e-20	97.1	502	0.142	0.213	O61495_DROME Nuclear fallout OS=Drosophila melanogaster OX=7227 GN=nuf PE=2 SV=1
12	Q8SYQ0	4.84e-20	96.7	502	0.130	0.195	Q8SYQ0_DROME RE46851p OS=Drosophila melanogaster OX=7227 GN=nuf PE=1 SV=1
13	Q6NN29	7.21e-20	96.3	528	0.128	0.184	Q6NN29_DROME Nuclear fallout, isoform E OS=Drosophila melanogaster OX=7227 GN=nuf PE=2 SV=1
14	M9NDQ8	1.34e-17	89.0	530	0.130	0.185	M9NDQ8_DROME Nuclear fallout, isoform G OS=Drosophila melanogaster OX=7227 GN=nuf PE=4 SV=1
15	M9NE94	1.49e-17	89.0	529	0.130	0.185	M9NE94_DROME Nuclear fallout, isoform H OS=Drosophila melanogaster OX=7227 GN=nuf PE=4 SV=1
16	M9NFB8	1.64e-17	88.6	515	0.142	0.208	M9NFB8_DROME Nuclear fallout, isoform L OS=Drosophila melanogaster OX=7227 GN=nuf PE=4 SV=1
17	Q6TXF6	1.70e-17	89.7	867	0.066	0.058	Q6TXF6_RAT LRRGT00043 OS=Rattus norvegicus OX=10116 GN=Decr2 PE=1 SV=1
18	M9ND89	3.48e-17	87.8	541	0.128	0.179	M9ND89_DROME Nuclear fallout, isoform J OS=Drosophila melanogaster OX=7227 GN=nuf PE=4 SV=1
19	Q8T0E0	5.40e-17	84.7	305	0.128	0.318	Q8T0E0_DROME LD08622p OS=Drosophila melanogaster OX=7227 GN=nuf PE=2 SV=1
20	Q7KUK1	1.02e-16	84.0	316	0.128	0.307	Q7KUK1_DROME Nuclear fallout, isoform D OS=Drosophila melanogaster OX=7227 GN=nuf PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19220 Crescentin	1.6e+02	12.7	Crescentin protein
2	PF00036 EF-hand_1	0.53	21.0	EF hand
3	PF13202 EF-hand_5	1.1e+02	13.7	EF hand
4	PF13405 EF-hand_6	0.024	25.4	EF-hand domain
5	PF13499 EF-hand_7	0.0082	27.9	EF-hand domain pair
6	PF13833 EF-hand_8	0.52	21.5	EF-hand domain pair
7	PF14658 EF-hand_9	3.7e+02	12.9	EF-hand domain
8	PF09457 RBD-FIP	2.3e-17	73.9	FIP domain
9	PF14077 WD40_alt	17	16.7	Alternative WD40 repeat motif
10	PF06005 ZapB	32	16.4	Cell division protein ZapB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262305

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261890	0.999	Ras-related protein Rab-11A
2	9606.ENSP00000298316	0.997	ADP-ribosylation factor 6
3	9606.ENSP00000447300	0.997	Rab-3A-interacting protein
4	9606.ENSP00000429900	0.961	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1
5	9606.ENSP00000000233	0.960	ADP-ribosylation factor 5
6	9606.ENSP00000482620	0.902	Rab11 family-interacting protein 4
7	9606.ENSP00000334100	0.888	Exocyst complex component 7
8	9606.ENSP00000306010	0.887	ADP-ribosylation factor 4
9	9606.ENSP00000258098	0.869	Rab11 family-interacting protein 5
10	9606.ENSP00000354376	0.820	Ras-related protein Rab-25
11	9606.ENSP00000331342	0.816	Rab11 family-interacting protein 1
12	9606.ENSP00000347839	0.810	Rab11 family-interacting protein 2
13	9606.ENSP00000300935	0.803	Ras-related protein Rab-8A
14	9606.ENSP00000260762	0.788	Exocyst complex component 6
15	9606.ENSP00000305699	0.732	Protein Hook homolog 3
16	9606.ENSP00000385957	0.720	Kelch repeat and BTB domain containing 12
17	9606.ENSP00000327468	0.718	Kelch domain-containing protein 8B
18	9606.ENSP00000333547	0.715	Ras-related protein Rab-11B
19	9606.ENSP00000425587	0.712	Exocyst complex component 3
20	9606.ENSP00000396593	0.704	Dystrotelin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042803	1.000	protein homodimerization activity
GO:0031267	1.000	small GTPase binding
GO:0051959	0.595	dynein light intermediate chain binding
GO:0044877	0.378	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0065007	0.985	biological regulation
GO:0050794	0.981	regulation of cellular process
GO:0006810	0.947	transport
GO:0051641	0.944	cellular localization
GO:0032879	0.904	regulation of localization
GO:0016192	0.885	vesicle-mediated transport
GO:0051649	0.852	establishment of localization in cell
GO:0046907	0.729	intracellular transport
GO:0060341	0.714	regulation of cellular localization
GO:0023051	0.712	regulation of signaling
GO:0032880	0.704	regulation of protein localization
GO:0051049	0.658	regulation of transport
GO:0010646	0.617	regulation of cell communication
GO:0051046	0.582	regulation of secretion
GO:0048519	0.404	negative regulation of biological process
GO:0051726	0.357	regulation of cell cycle
GO:0048523	0.341	negative regulation of cellular process
GO:1903530	0.331	regulation of secretion by cell
GO:0016043	0.324	cellular component organization
GO:0010564	0.311	regulation of cell cycle process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0005829	0.997	cytosol
GO:0016020	0.995	membrane
GO:0005654	0.990	nucleoplasm
GO:0005886	0.988	plasma membrane
GO:0005815	0.985	microtubule organizing center
GO:0005739	0.982	mitochondrion
GO:0031982	0.950	vesicle
GO:0005813	0.944	centrosome
GO:0031410	0.933	cytoplasmic vesicle
GO:0005768	0.916	endosome
GO:0098590	0.889	plasma membrane region
GO:0045171	0.805	intercellular bridge
GO:0034451	0.761	centriolar satellite
GO:0055037	0.682	recycling endosome
GO:0031090	0.579	organelle membrane
GO:0030496	0.533	midbody
GO:0032153	0.526	cell division site
GO:0032154	0.422	cleavage furrow

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]