StarFunc result for job id O75155

User Input

>input (1236 residues)
MSTAAFHISSLLEKMTSSDKDFRFMATSDLMSELQKDSIQLDEDSERKVVKMLLRLLEDK
NGEVQNLAVKCLGPLVVKVKEYQVETIVDTLCTNMRSDKEQLRDIAGIGLKTVLSELPPA
ATGSGLATNVCRKITGQLTSAIAQQEDVAVQLEALDILSDMLSRLGVPLGAFHASLLHCL
LPQLSSPRLAVRKRAVGALGHLAAACSTDLFVELADHLLDRLPGPRVPTSPTAIRTLIQC
LGSVGRQAGHRLGAHLDRLVPLVEDFCNLDDDELRESCLQAFEAFLRKCPKEMGPHVPNV
TSLCLQYIKHDPNYNYDSDEDEEQMETEDSEFSEQESEDEYSDDDDMSWKVRRAAAKCIA
ALISSRPDLLPDFHCTLAPVLIRRFKEREENVKADVFTAYIVLLRQTQPPKGWLEAMEEP
TQTGSNLHMLRGQVPLVVKALQRQLKDRSVRARQGCFSLLTELAGVLPGSLAEHMPVLVS
GIIFSLADRSSSSTIRMDALAFLQGLLGTEPAEAFHPHLPILLPPVMACVADSFYKIAAE
ALVVLQELVRALWPLHRPRMLDPEPYVGEMSAVTLARLRATDLDQEVKERAISCMGHLVG
HLGDRLGDDLEPTLLLLLDRLRNEITRLPAIKALTLVAVSPLQLDLQPILAEALHILASF
LRKNQRALRLATLAALDALAQSQGLSLPPSAVQAVLAELPALVNESDMHVAQLAVDFLAT
VTQAQPASLVEVSGPVLSELLRLLRSPLLPAGVLAAAEGFLQALVGTRPPCVDYAKLISL
LTAPVYEQAVDGGPGLHKQVFHSLARCVAALSAACPQEAASTASRLVCDARSPHSSTGVK
VLAFLSLAEVGQVAGPGHQRELKAVLLEALGSPSEDVRAAASYALGRVGAGSLPDFLPFL
LEQIEAEPRRQYLLLHSLREALGAAQPDSLKPYAEDIWALLFQRCEGAEEGTRGVVAECI
GKLVLVNPSFLLPRLRKQLAAGRPHTRSTVITAVKFLISDQPHPIDPLLKSFIGEFMESL
QDPDLNVRRATLAFFNSAVHNKPSLVRDLLDDILPLLYQETKIRRDLIREVEMGPFKHTV
DDGLDVRKAAFECMYSLLESCLGQLDICEFLNHVEDGLKDHYDIRMLTFIMVARLATLCP
APVLQRVDRLIEPLRATCTAKVKAGSVKQEFEKQDELKRSAMRAVAALLTIPEVGKSPIM
ADFSSQIRSNPELAALFESIQKDSASAPSTDSMELS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75155	1.000	1.000	0.000	1236	1.000	1.000	O75155.pdb.gz	CAND2_HUMAN Cullin-associated NEDD8-dissociated protein 2 OS=Homo sapiens OX=9606 GN=CAND2 PE=1 SV=3
2	AFDB:Q9R0L4	0.973	0.945	0.000	1273	0.907	0.881	Q9R0L4.pdb.gz	CAND2_RAT Cullin-associated NEDD8-dissociated protein 2 OS=Rattus norvegicus OX=10116 GN=Cand2 PE=1 SV=1
3	AFDB:P97536	0.945	0.950	1.890E-93	1230	0.622	0.625	P97536.pdb.gz	CAND1_RAT Cullin-associated NEDD8-dissociated protein 1 OS=Rattus norvegicus OX=10116 GN=Cand1 PE=1 SV=1
4	AFDB:Q9VKY2	0.925	0.916	5.965E-82	1248	0.523	0.518	Q9VKY2.pdb.gz	CAND1_DROME Cullin-associated NEDD8-dissociated protein 1 OS=Drosophila melanogaster OX=7227 GN=Cand1 PE=2 SV=1
5	PDB:4a0cA	0.768	0.816	1.518E-76	1155	0.590	0.631	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
6	AFDB:Q8L5Y6	0.856	0.867	6.431E-67	1219	0.382	0.387	Q8L5Y6.pdb.gz	CAND1_ARATH Cullin-associated NEDD8-dissociated protein 1 OS=Arabidopsis thaliana OX=3702 GN=CAND1 PE=1 SV=1
7	AFDB:G5ED41	0.875	0.850	8.853E-61	1274	0.345	0.335	G5ED41.pdb.gz	CAND1_CAEEL Cullin-associated NEDD8-dissociated protein 1 OS=Caenorhabditis elegans OX=6239 GN=cand-1 PE=1 SV=1
8	AFDB:A0A0C4DGH5	0.475	0.754	8.017E-51	770	0.375	0.603	A0A0C4DGH5.pdb.gz	A0A0C4DGH5_HUMAN Cullin associated and neddylation dissociated 1 (Fragment) OS=Homo sapiens OX=9606 GN=CAND1 PE=1 SV=1
9	AFDB:Q5BAH2	0.668	0.785	1.353E-35	1041	0.233	0.277	Q5BAH2.pdb.gz	CAN1C_EMENI Cullin-associated NEDD8-dissociated protein 1, C-terminal part OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=candA-C PE=1 SV=1
10	AFDB:Q9P3A8	0.660	0.667	2.832E-33	1220	0.195	0.198	Q9P3A8.pdb.gz	CAND1_SCHPO Cullin-associated NEDD8-dissociated protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=knd1 PE=3 SV=1
11	AFDB:Q387F9	0.681	0.688	6.636E-25	1220	0.181	0.184	Q387F9.pdb.gz	Q387F9_TRYB2 TATA-binding protein interacting (TIP20) domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0210 PE=3 SV=1
12	PDB:6xu2A	0.321	0.353	2.649E-14	1091	0.117	0.132	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
13	PDB:7unkA	0.300	0.344	9.819E-14	1047	0.130	0.154	7unkA.pdb.gz
14	PDB:3w3uA	0.264	0.301	2.246E-13	1030	0.129	0.155	3w3uA.pdb.gz
15	PDB:3w3zA	0.298	0.345	4.963E-13	1013	0.125	0.153	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
16	PDB:4jlqA	0.297	0.405	5.697E-13	840	0.130	0.192	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
17	PDB:6bcuA	0.221	0.147	6.104E-13	2204	0.151	0.085	6bcuA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
18	PDB:6zwmB	0.204	0.139	3.194E-12	2185	0.146	0.082	6zwmB.pdb.gz	The 3.2- angstrom resolution structure of human mTORC2.
19	PDB:6ahd1	0.318	0.363	2.527E-11	1048	0.111	0.131	6ahd1.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
20	PDB:5gm6G	0.296	0.388	2.616E-11	875	0.111	0.157	5gm6G.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DGH5	0.0	779	770	0.305	0.490	A0A0C4DGH5_HUMAN Cullin associated and neddylation dissociated 1 (Fragment) OS=Homo sapiens OX=9606 GN=CAND1 PE=1 SV=1
2	G5ED41	0.0	669	1274	0.349	0.338	CAND1_CAEEL Cullin-associated NEDD8-dissociated protein 1 OS=Caenorhabditis elegans OX=6239 GN=cand-1 PE=1 SV=1
3	O75155	0.0	2485	1236	1.000	1.000	CAND2_HUMAN Cullin-associated NEDD8-dissociated protein 2 OS=Homo sapiens OX=9606 GN=CAND2 PE=1 SV=3
4	P97536	0.0	1580	1230	0.627	0.630	CAND1_RAT Cullin-associated NEDD8-dissociated protein 1 OS=Rattus norvegicus OX=10116 GN=Cand1 PE=1 SV=1
5	Q6ZQ38	0.0	1581	1230	0.628	0.631	CAND1_MOUSE Cullin-associated NEDD8-dissociated protein 1 OS=Mus musculus OX=10090 GN=Cand1 PE=1 SV=2
6	Q6ZQ73	0.0	2172	1235	0.906	0.907	CAND2_MOUSE Cullin-associated NEDD8-dissociated protein 2 OS=Mus musculus OX=10090 GN=Cand2 PE=1 SV=2
7	Q86VP6	0.0	1579	1230	0.627	0.630	CAND1_HUMAN Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens OX=9606 GN=CAND1 PE=1 SV=2
8	Q8L5Y6	0.0	817	1219	0.389	0.395	CAND1_ARATH Cullin-associated NEDD8-dissociated protein 1 OS=Arabidopsis thaliana OX=3702 GN=CAND1 PE=1 SV=1
9	Q9R0L4	0.0	2131	1273	0.909	0.883	CAND2_RAT Cullin-associated NEDD8-dissociated protein 2 OS=Rattus norvegicus OX=10116 GN=Cand2 PE=1 SV=1
10	Q9VKY2	0.0	1238	1248	0.521	0.516	CAND1_DROME Cullin-associated NEDD8-dissociated protein 1 OS=Drosophila melanogaster OX=7227 GN=Cand1 PE=2 SV=1
11	Q5BAH2	1.73e-100	346	1041	0.248	0.294	CAN1C_EMENI Cullin-associated NEDD8-dissociated protein 1, C-terminal part OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=candA-C PE=1 SV=1
12	Q9P3A8	5.90e-30	131	1220	0.089	0.090	CAND1_SCHPO Cullin-associated NEDD8-dissociated protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=knd1 PE=3 SV=1
13	C8VP82	3.64e-14	77.8	339	0.059	0.215	CAN1N_EMENI Cullin-associated NEDD8-dissociated protein 1, N-terminal part OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=candA-N PE=1 SV=1
14	Q387F9	1.14e-05	52.4	1220	0.052	0.052	Q387F9_TRYB2 TATA-binding protein interacting (TIP20) domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0210 PE=3 SV=1
15	Q8TEX9	6.32e-04	46.6	1081	0.040	0.046	IPO4_HUMAN Importin-4 OS=Homo sapiens OX=9606 GN=IPO4 PE=1 SV=2
16	C8V020	0.019	42.0	2672	0.061	0.028	C8V020_EMENI Translational activator, putative (AFU_orthologue AFUA_2G07960) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10734 PE=4 SV=1
17	Q8VI75	0.089	39.7	1082	0.035	0.040	IPO4_MOUSE Importin-4 OS=Mus musculus OX=10090 GN=Ipo4 PE=1 SV=1
18	B4E2H2	0.13	39.3	1728	0.070	0.050	B4E2H2_HUMAN Serine/threonine-protein kinase mTOR OS=Homo sapiens OX=9606 PE=2 SV=1
19	P42346	0.13	39.3	2549	0.070	0.034	MTOR_RAT Serine/threonine-protein kinase mTOR OS=Rattus norvegicus OX=10116 GN=Mtor PE=1 SV=1
20	Q9JLN9	0.13	39.3	2549	0.070	0.034	MTOR_MOUSE Serine/threonine-protein kinase mTOR OS=Mus musculus OX=10090 GN=Mtor PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01602 Adaptin_N	1e-08	45.9	Adaptin N terminal region
2	PF00514 Arm	2	19.8	Armadillo/beta-catenin-like repeat
3	PF12717 Cnd1	6.8e-11	54.0	non-SMC mitotic condensation complex subunit 1
4	PF04118 Dopey_N	51	14.4	Dopey, N-terminal
5	PF07539 DRIM	0.17	21.8	Down-regulated in metastasis
6	PF20416 DUF6700	5.2e+02	11.5	Domain of unknown function (DUF6700)
7	PF02985 HEAT	4.8e-14	62.3	HEAT repeat
8	PF13646 HEAT_2	3.9e-19	80.2	HEAT repeats
9	PF13513 HEAT_EZ	1.8e-12	58.8	HEAT-like repeat
10	PF12460 MMS19_C	3.5e-05	34.7	RNAPII transcription regulator C-terminal
11	PF20168 PDS5	0.092	22.2	Sister chromatid cohesion protein PDS5 protein
12	PF14663 RasGEF_N_2	3.6e+02	13.0	Rapamycin-insensitive companion of mTOR RasGEF_N domain
13	PF08167 RIX1	0.79	20.9	rRNA processing/ribosome biogenesis
14	PF10363 RTP1_C1	0.4	22.2	Required for nuclear transport of RNA pol II C-terminus 1
15	PF08623 TIP120	5.1e-58	207.0	TATA-binding protein interacting (TIP20)
16	PF08064 UME	5.3	18.4	UME (NUC010) domain
17	PF03224 V-ATPase_H_N	3.9e+02	11.7	V-ATPase subunit H
18	PF07814 WAPL	2.1e+02	12.1	Wings apart-like protein regulation of heterochromatin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000387641

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000326804	0.939	Cullin-1
2	9606.ENSP00000358795	0.700	E3 ubiquitin-protein ligase NEURL1
3	9606.ENSP00000375942	0.696	TATA-box-binding protein
4	9606.ENSP00000447731	0.690	Transmembrane protein 116
5	9606.ENSP00000296543	0.689	N-alpha-acetyltransferase 15, NatA auxiliary subunit
6	9606.ENSP00000329715	0.674	Developmentally-regulated GTP-binding protein 1
7	9606.ENSP00000216225	0.603	E3 ubiquitin-protein ligase RBX1
8	9606.ENSP00000378289	0.594	Synaptopodin 2-like protein
9	9606.ENSP00000376808	0.591	Cullin-5
10	9606.ENSP00000309198	0.586	Ubiquitin-protein ligase E3C
11	9606.ENSP00000264414	0.576	Cullin-3
12	9606.ENSP00000358147	0.568	CDK2-associated and cullin domain-containing protein 1
13	9606.ENSP00000408288	0.551	Protein phosphatase 1 regulatory subunit 3E
14	9606.ENSP00000350512	0.547	COP9 signalosome complex subunit 5
15	9606.ENSP00000364589	0.544	Cullin-4A
16	9606.ENSP00000384109	0.544	Cullin-4B
17	9606.ENSP00000444856	0.544	Cullin-2
18	9606.ENSP00000261726	0.536	Homeobox protein cut-like 2
19	9606.ENSP00000370639	0.533	Acetylserotonin O-methyltransferase
20	9606.ENSP00000386239	0.531	Tonsoku-like protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140296	0.991	general transcription initiation factor binding
GO:0017025	0.970	TBP-class protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.983	biological regulation
GO:0050789	0.958	regulation of biological process
GO:0009987	0.956	cellular process
GO:0050794	0.841	regulation of cellular process
GO:0060255	0.677	regulation of macromolecule metabolic process
GO:0051171	0.582	regulation of nitrogen compound metabolic process
GO:0008152	0.580	metabolic process
GO:0080090	0.547	regulation of primary metabolic process
GO:0071704	0.500	organic substance metabolic process
GO:0044238	0.479	primary metabolic process
GO:0006807	0.461	nitrogen compound metabolic process
GO:0071840	0.371	cellular component organization or biogenesis
GO:1901564	0.369	organonitrogen compound metabolic process
GO:0019538	0.358	protein metabolic process
GO:0036211	0.338	protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005829	0.992	cytosol
GO:0043233	0.700	organelle lumen
GO:0031981	0.692	nuclear lumen
GO:0005654	0.627	nucleoplasm
GO:0032991	0.336	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]