StarFunc result for job id O75159

User Input

>input (536 residues)
MDKVGKMWNNFKYRCQNLFGHEGGSRSENVDMNSNRCLSVKEKNISIGDSTPQQQSSPLR
ENIALQLGLSPSKNSSRRNQNCATEIPQIVEISIEKDNDSCVTPGTRLARRDSYSRHAPW
GGKKKHSCSTKTQSSLDADKKFGRTRSGLQRRERRYGVSSVHDMDSVSSRTVGSRSLRQR
LQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPV
SPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLG
PKLAPGMTEISGDSSAIPQANCDSEEDTTTLCLQSRRQKQRQISGDSHTHVSRQGAWKVH
TQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFR
RYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTF
PFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O54928	0.480	0.480	9.285E-85	536	0.944	0.944	O54928.pdb.gz	SOCS5_MOUSE Suppressor of cytokine signaling 5 OS=Mus musculus OX=10090 GN=Socs5 PE=1 SV=2
2	PDB:8dcxB	0.170	0.363	3.181E-6	236	0.054	0.123	8dcxB.pdb.gz
3	PDB:4gwfA	0.156	0.168	2.350E-5	497	0.056	0.060	4gwfA.pdb.gz
4	PDB:1ka6A	0.149	0.625	3.344E-5	107	0.039	0.196	1ka6A.pdb.gz	A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
5	PDB:4fl2A	0.166	0.161	3.344E-5	555	0.047	0.045	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
6	PDB:7myoB	0.145	0.264	3.546E-5	286	0.050	0.094	7myoB.pdb.gz	Cryo-EM structures of PI3K alpha reveal conformational changes during inhibition and activation.
7	AFDB:Q8INJ8	0.177	0.093	4.304E-5	1052	0.146	0.074	Q8INJ8.pdb.gz	Q8INJ8_DROME Tyrosine-protein kinase OS=Drosophila melanogaster OX=7227 GN=Csk PE=3 SV=2
8	PDB:1k9aB	0.156	0.186	6.386E-5	441	0.043	0.052	1k9aB.pdb.gz
9	PDB:5xzrA	0.146	0.151	1.084E-4	519	0.063	0.066	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
10	PDB:4k2rA	0.176	0.171	1.543E-4	551	0.056	0.054	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
11	PDB:3qwyA	0.147	0.420	1.636E-4	170	0.050	0.159	3qwyA.pdb.gz
12	PDB:3ps5A	0.133	0.135	1.952E-4	529	0.043	0.043	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
13	AFDB:Q96B23	0.073	0.091	1.074E-1	404	0.101	0.134	Q96B23.pdb.gz	ARK2N_HUMAN Protein ARK2N OS=Homo sapiens OX=9606 GN=ARK2N PE=1 SV=3
14	AFDB:Q7Z353	0.066	0.055	1.719E-1	690	0.118	0.091	Q7Z353.pdb.gz	HDX_HUMAN Highly divergent homeobox OS=Homo sapiens OX=9606 GN=HDX PE=1 SV=1
15	AFDB:Q68CZ2	0.156	0.062	2.175E-1	1445	0.157	0.058	Q68CZ2.pdb.gz	TENS3_HUMAN Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=2
16	AFDB:A0A0B4LHS3	0.077	0.107	2.919E-1	350	0.101	0.154	A0A0B4LHS3.pdb.gz	A0A0B4LHS3_DROME Microtubule-associated protein OS=Drosophila melanogaster OX=7227 GN=tau PE=1 SV=1
17	AFDB:Q9P2B4	0.052	0.046	5.574E-1	639	0.112	0.094	Q9P2B4.pdb.gz	CT2NL_HUMAN CTTNBP2 N-terminal-like protein OS=Homo sapiens OX=9606 GN=CTTNBP2NL PE=1 SV=2
18	AFDB:Q8W1W6	0.059	0.061	6.649E-1	520	0.088	0.090	Q8W1W6.pdb.gz	MYB33_ARATH Transcription factor MYB33 OS=Arabidopsis thaliana OX=3702 GN=MYB33 PE=2 SV=1
19	AFDB:A0A0G2K069	0.056	0.049	7.933E-1	624	0.088	0.075	A0A0G2K069.pdb.gz	A0A0G2K069_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=2
20	AFDB:Q80ZF5	0.053	0.038	1.064	803	0.099	0.066	Q80ZF5.pdb.gz	Q80ZF5_RAT non-specific serine/threonine protein kinase (Fragment) OS=Rattus norvegicus OX=10116 GN=Obscurin PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O54928	0.0	1041	536	0.944	0.944	SOCS5_MOUSE Suppressor of cytokine signaling 5 OS=Mus musculus OX=10090 GN=Socs5 PE=1 SV=2
2	O75159	0.0	1123	536	1.000	1.000	SOCS5_HUMAN Suppressor of cytokine signaling 5 OS=Homo sapiens OX=9606 GN=SOCS5 PE=1 SV=1
3	Q8WXH5	1.26e-144	425	440	0.425	0.518	SOCS4_HUMAN Suppressor of cytokine signaling 4 OS=Homo sapiens OX=9606 GN=SOCS4 PE=1 SV=1
4	Q91ZA6	7.47e-142	418	436	0.394	0.484	SOCS4_MOUSE Suppressor of cytokine signaling 4 OS=Mus musculus OX=10090 GN=Socs4 PE=2 SV=2
5	Q9VJA1	6.52e-78	259	633	0.218	0.185	Q9VJA1_DROME Suppressor of cytokine signaling SOCS36E OS=Drosophila melanogaster OX=7227 GN=Socs36E PE=2 SV=2
6	Q86P82	9.61e-78	258	634	0.218	0.185	Q86P82_DROME SD04308p OS=Drosophila melanogaster OX=7227 GN=Socs36E PE=2 SV=1
7	Q8INY1	4.55e-77	259	737	0.218	0.159	Q8INY1_DROME Suppressor of cytokine signaling at 36E, isoform D OS=Drosophila melanogaster OX=7227 GN=Socs36E PE=4 SV=2
8	O14544	2.07e-23	105	535	0.114	0.114	SOCS6_HUMAN Suppressor of cytokine signaling 6 OS=Homo sapiens OX=9606 GN=SOCS6 PE=1 SV=2
9	Q9JLY0	3.06e-23	105	533	0.114	0.114	SOCS6_MOUSE Suppressor of cytokine signaling 6 OS=Mus musculus OX=10090 GN=Socs6 PE=1 SV=2
10	O14508	2.88e-16	79.7	198	0.103	0.278	SOCS2_HUMAN Suppressor of cytokine signaling 2 OS=Homo sapiens OX=9606 GN=SOCS2 PE=1 SV=1
11	O88582	9.90e-16	78.2	198	0.104	0.283	SOCS2_RAT Suppressor of cytokine signaling 2 OS=Rattus norvegicus OX=10116 GN=Socs2 PE=2 SV=1
12	O35717	1.40e-15	77.4	198	0.104	0.283	SOCS2_MOUSE Suppressor of cytokine signaling 2 OS=Mus musculus OX=10090 GN=Socs2 PE=1 SV=1
13	Q9VX18	3.58e-15	81.3	1016	0.104	0.055	Q9VX18_DROME Suppressor of cytokine signaling at 16D, isoform A OS=Drosophila melanogaster OX=7227 GN=Socs16D PE=4 SV=4
14	M9PHY7	3.85e-15	81.3	1021	0.104	0.055	M9PHY7_DROME Suppressor of cytokine signaling at 16D, isoform B OS=Drosophila melanogaster OX=7227 GN=Socs16D PE=4 SV=1
15	V9Q6E2	8.87e-15	75.5	200	0.103	0.275	V9Q6E2_SALSA Suppressor of cytokine signaling 2a OS=Salmo salar OX=8030 GN=SOCS2a PE=2 SV=1
16	O70512	4.66e-14	74.3	256	0.101	0.211	CISH_RAT Cytokine-inducible SH2-containing protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Cish PE=2 SV=1
17	A0A087X1Q5	1.12e-13	75.9	553	0.090	0.087	A0A087X1Q5_HUMAN Suppressor of cytokine signaling 7 (Fragment) OS=Homo sapiens OX=9606 GN=SOCS7 PE=1 SV=2
18	Q8VHQ2	1.16e-13	75.9	579	0.090	0.083	SOCS7_MOUSE Suppressor of cytokine signaling 7 OS=Mus musculus OX=10090 GN=Socs7 PE=1 SV=1
19	O14512	1.18e-13	75.9	581	0.090	0.083	SOCS7_HUMAN Suppressor of cytokine signaling 7 OS=Homo sapiens OX=9606 GN=SOCS7 PE=1 SV=2
20	A0A5F9YLF9	1.30e-13	75.9	645	0.090	0.074	A0A5F9YLF9_HUMAN Suppressor of cytokine signaling 7 OS=Homo sapiens OX=9606 GN=SOCS7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12820 BRCT_assoc	65	14.8	Serine-rich domain associated with BRCT
2	PF00017 SH2	2.2e-05	35.8	SH2 domain
3	PF12610 SOCS	1.5e-12	59.1	Suppressor of cytokine signalling
4	PF07525 SOCS_box	3.6e-05	35.3	SOCS box

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000305133

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000391676	0.989	Tyrosine-protein kinase JAK3
2	9606.ENSP00000343204	0.988	Tyrosine-protein kinase JAK1
3	9606.ENSP00000371067	0.985	Tyrosine-protein kinase JAK2
4	9606.ENSP00000275493	0.958	Epidermal growth factor receptor
5	9606.ENSP00000376808	0.958	Cullin-5
6	9606.ENSP00000379111	0.947	Interleukin-4 receptor subunit alpha
7	9606.ENSP00000231449	0.943	Interleukin-4
8	9606.ENSP00000293328	0.930	Signal transducer and activator of transcription 5B
9	9606.ENSP00000341208	0.930	Signal transducer and activator of transcription 5A
10	9606.ENSP00000478121	0.917	Elongin-C
11	9606.ENSP00000262306	0.915	Elongin-B
12	9606.ENSP00000363318	0.915	Cytokine receptor common subunit gamma
13	9606.ENSP00000264657	0.859	Signal transducer and activator of transcription 3
14	9606.ENSP00000330341	0.851	Suppressor of cytokine signaling 3
15	9606.ENSP00000354394	0.843	Signal transducer and activator of transcription 1-alpha/beta
16	9606.ENSP00000431885	0.811	Non-receptor tyrosine-protein kinase TYK2
17	9606.ENSP00000273480	0.756	RING-box protein 2
18	9606.ENSP00000381034	0.738	Suppressor of cytokine signaling 6
19	9606.ENSP00000482229	0.710	Suppressor of cytokine signaling 7
20	9606.ENSP00000262866	0.697	Src-like-adapter 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0005154	0.925	epidermal growth factor receptor binding
GO:0019899	0.522	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0019222	0.990	regulation of metabolic process
GO:0009966	0.982	regulation of signal transduction
GO:0048523	0.977	negative regulation of cellular process
GO:0048518	0.976	positive regulation of biological process
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0009968	0.968	negative regulation of signal transduction
GO:0048522	0.959	positive regulation of cellular process
GO:0009987	0.958	cellular process
GO:0051246	0.938	regulation of protein metabolic process
GO:1901185	0.934	negative regulation of ERBB signaling pathway
GO:0019220	0.930	regulation of phosphate metabolic process
GO:0050896	0.928	response to stimulus
GO:0050730	0.922	regulation of peptidyl-tyrosine phosphorylation
GO:0045859	0.921	regulation of protein kinase activity
GO:0009892	0.895	negative regulation of metabolic process
GO:0010605	0.892	negative regulation of macromolecule metabolic process
GO:0051716	0.891	cellular response to stimulus
GO:0023052	0.885	signaling
GO:0007154	0.885	cell communication
GO:0007165	0.877	signal transduction
GO:0031329	0.868	regulation of cellular catabolic process
GO:0051247	0.861	positive regulation of protein metabolic process
GO:0042059	0.859	negative regulation of epidermal growth factor receptor signaling pathway
GO:0042176	0.857	regulation of protein catabolic process
GO:0007166	0.854	cell surface receptor signaling pathway
GO:0031400	0.835	negative regulation of protein modification process
GO:0031324	0.832	negative regulation of cellular metabolic process
GO:0061097	0.814	regulation of protein tyrosine kinase activity
GO:0031325	0.813	positive regulation of cellular metabolic process
GO:0045936	0.804	negative regulation of phosphate metabolic process
GO:0045862	0.801	positive regulation of proteolysis
GO:0010469	0.792	regulation of signaling receptor activity
GO:1903050	0.789	regulation of proteolysis involved in protein catabolic process
GO:0050732	0.789	negative regulation of peptidyl-tyrosine phosphorylation
GO:0009896	0.780	positive regulation of catabolic process
GO:0010468	0.775	regulation of gene expression
GO:0051239	0.770	regulation of multicellular organismal process
GO:0031331	0.769	positive regulation of cellular catabolic process
GO:2000058	0.765	regulation of ubiquitin-dependent protein catabolic process
GO:0045732	0.759	positive regulation of protein catabolic process
GO:0061136	0.757	regulation of proteasomal protein catabolic process
GO:1903052	0.757	positive regulation of proteolysis involved in protein catabolic process
GO:0042221	0.756	response to chemical
GO:0032434	0.745	regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0006469	0.734	negative regulation of protein kinase activity
GO:0070887	0.714	cellular response to chemical stimulus
GO:2000060	0.702	positive regulation of ubiquitin-dependent protein catabolic process
GO:0010033	0.701	response to organic substance
GO:0071310	0.683	cellular response to organic substance
GO:0002682	0.665	regulation of immune system process
GO:1901800	0.641	positive regulation of proteasomal protein catabolic process
GO:0007169	0.631	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0006950	0.613	response to stress
GO:0048584	0.581	positive regulation of response to stimulus
GO:0019221	0.540	cytokine-mediated signaling pathway
GO:0032436	0.511	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0051240	0.510	positive regulation of multicellular organismal process
GO:0030155	0.473	regulation of cell adhesion
GO:0002684	0.466	positive regulation of immune system process
GO:0022407	0.452	regulation of cell-cell adhesion
GO:0002694	0.428	regulation of leukocyte activation
GO:0050793	0.421	regulation of developmental process
GO:0051249	0.420	regulation of lymphocyte activation
GO:0080134	0.404	regulation of response to stress
GO:0051094	0.404	positive regulation of developmental process
GO:1903037	0.376	regulation of leukocyte cell-cell adhesion
GO:0007259	0.357	receptor signaling pathway via JAK-STAT
GO:0050863	0.355	regulation of T cell activation
GO:0071704	0.346	organic substance metabolic process
GO:0001817	0.333	regulation of cytokine production
GO:0009719	0.325	response to endogenous stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0070013	0.314	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]