StarFunc result for job id O75161

User Input

>input (1426 residues)
MNDWHRIFTQNVLVPPHPQRARQPWKESTAFQCVLKWLDGPVIRQGVLEVLSEVECHLRV
SFFDVTYRHFFGRTWKTTVKPTKRPPSRIVFNEPLYFHTSLNHPHIVAVVEVVAEGKKRD
GSLQTLSCGFGILRIFSNQPDSPISASQDKRLRLYHGTPRALLHPLLQDPAEQNRHMTLI
ENCSLQYTLKPHPALEPAFHLLPENLLVSGLQQIPGLLPAHGESGDALRKPRLQKPITGH
LDDLFFTLYPSLEKFEEELLELHVQDHFQEGCGPLDGGALEILERRLRVGVHNGLGFVQR
PQVVVLVPEMDVALTRSASFSRKVVSSSKTSSGSQALVLRSRLRLPEMVGHPAFAVIFQL
EYVFSSPAGVDGNAASVTSLSNLACMHMVRWAVWNPLLEADSGRVTLPLQGGIQPNPSHC
LVYKVPSASMSSEEVKQVESGTLRFQFSLGSEEHLDAPTEPVSGPKVERRPSRKPPTSPS
SPPAPVPRVLAAPQNSPVGPGLSISQLAASPRSPTQHCLARPTSQLPHGSQASPAQAQEF
PLEAGISHLEADLSQTSLVLETSIAEQLQELPFTPLHAPIVVGTQTRSSAGQPSRASMVL
LQSSGFPEILDANKQPAEAVSATEPVTFNPQKEESDCLQSNEMVLQFLAFSRVAQDCRGT
SWPKTVYFTFQFYRFPPATTPRLQLVQLDEAGQPSSGALTHILVPVSRDGTFDAGSPGFQ
LRYMVGPGFLKPGERRCFARYLAVQTLQIDVWDGDSLLLIGSAAVQMKHLLRQGRPAVQA
SHELEVVATEYEQDNMVVSGDMLGFGRVKPIGVHSVVKGRLHLTLANVGHPCEQKVRGCS
TLPPSRSRVISNDGASRFSGGSLLTTGSSRRKHVVQAQKLADVDSELAAMLLTHARQGKG
PQDVSRESDATRRRKLERMRSVRLQEAGGDLGRRGTSVLAQQSVRTQHLRDLQVIAAYRE
RTKAESIASLLSLAITTEHTLHATLGVAEFFEFVLKNPHNTQHTVTVEIDNPELSVIVDS
QEWRDFKGAAGLHTPVEEDMFHLRGSLAPQLYLRPHETAHVPFKFQSFSAGQLAMVQASP
GLSNEKGMDAVSPWKSSAVPTKHAKVLFRASGGKPIAVLCLTVELQPHVVDQVFRFYHPE
LSFLKKAIRLPPWHTFPGAPVGMLGEDPPVHVRCSDPNVICETQNVGPGEPRDIFLKVAS
GPSPEIKDFFVIIYSDRWLATPTQTWQVYLHSLQRVDVSCVAGQLTRLSLVLRGTQTVRK
VRAFTSHPQELKTDPKGVFVLPPRGVQDLHVGVRPLRAGSRFVHLNLVDVDCHQLVASWL
VCLCCRQPLISKAFEIMLAAGEGKGVNKRITYTNPYPSRRTFHLHSDHPELLRFREDSFQ
VGGGETYTIGLQFAPSQRVGEEEILIYINDHEDKNEEAFCVKVIYQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QSP6	0.518	0.521	0.000	1417	0.457	0.459	F1QSP6.pdb.gz
2	AFDB:G3V9Y6	0.610	0.609	0.000	1428	0.777	0.776	G3V9Y6.pdb.gz	G3V9Y6_RAT Nephrocystin 4 OS=Rattus norvegicus OX=10116 GN=Nphp4 PE=4 SV=1
3	AFDB:O75161	1.000	1.000	0.000	1426	1.000	1.000	O75161.pdb.gz	NPHP4_HUMAN Nephrocystin-4 OS=Homo sapiens OX=9606 GN=NPHP4 PE=1 SV=2
4	PDB:7sqcO0	0.099	0.119	4.461E-17	1140	0.038	0.047	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
5	AFDB:D4P3R7	0.079	0.065	3.700E-15	1940	0.067	0.049	D4P3R7.pdb.gz	CFA74_CHLRE Cilia- and flagella-associated protein 74 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP74 PE=1 SV=1
6	AFDB:E9QHV7	0.092	0.096	6.634E-12	1342	0.072	0.076	E9QHV7.pdb.gz
7	AFDB:Q9V7H4	0.104	0.096	7.161E-11	1567	0.075	0.068	Q9V7H4.pdb.gz	TM131_DROME Transmembrane protein 131 homolog OS=Drosophila melanogaster OX=7227 GN=CG8370 PE=1 SV=2
8	PDB:4aq1A	0.058	0.108	4.367E-10	721	0.040	0.079	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
9	PDB:7sqcO1	0.074	0.143	3.850E-9	673	0.022	0.048	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
10	PDB:4bxsV	0.059	0.061	1.436E-8	1262	0.039	0.044	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
11	PDB:5n4lA	0.055	0.065	6.231E-8	1034	0.037	0.051	5n4lA.pdb.gz	Rat ceruloplasmin: a new labile copper binding site and zinc/copper mosaic.
12	PDB:5a42A	0.075	0.069	6.555E-8	1597	0.091	0.081	5a42A.pdb.gz
13	PDB:4ziqA	0.073	0.073	1.034E-7	1450	0.076	0.074	4ziqA.pdb.gz
14	AFDB:Q5VV43	0.051	0.065	1.049E-7	1072	0.076	0.102	Q5VV43.pdb.gz	K0319_HUMAN Dyslexia-associated protein KIAA0319 OS=Homo sapiens OX=9606 GN=KIAA0319 PE=1 SV=1
15	PDB:1kcwA	0.051	0.069	1.550E-7	1017	0.036	0.051	1kcwA.pdb.gz	The X-ray structure of human serum ceruloplasmin at 3.1 angstrom: Nature of the copper centres.
16	PDB:4pygA	0.063	0.103	3.483E-7	685	0.020	0.042	4pygA.pdb.gz	Crystal structure of transglutaminase 2 with GTP complex and amino acid sequence evidence of evolution of GTP binding site.
17	PDB:6kzbC	0.063	0.112	3.664E-7	649	0.022	0.048	6kzbC.pdb.gz	Competitive Binding of Magnesium to Calcium Binding Sites Reciprocally Regulates Transamidase and GTP Hydrolysis Activity of Transglutaminase 2.
18	AFDB:Q3V1M1	0.042	0.029	1.253E-6	2594	0.101	0.056	Q3V1M1.pdb.gz	IGS10_MOUSE Immunoglobulin superfamily member 10 OS=Mus musculus OX=10090 GN=Igsf10 PE=2 SV=2
19	AFDB:Q66VB0	0.073	0.090	3.626E-6	1086	0.066	0.087	Q66VB0.pdb.gz	Q66VB0_ORYSJ No pollen OS=Oryza sativa subsp. japonica OX=39947 PE=2 SV=1
20	AFDB:A0A140LG84	0.060	0.079	5.436E-6	1017	0.039	0.055	A0A140LG84.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E1BJB5	0.0	2182	1430	0.785	0.783	E1BJB5_BOVIN Nephrocystin 4 OS=Bos taurus OX=9913 GN=NPHP4 PE=1 SV=3
2	G3V9Y6	0.0	2224	1428	0.778	0.777	G3V9Y6_RAT Nephrocystin 4 OS=Rattus norvegicus OX=10116 GN=Nphp4 PE=4 SV=1
3	O75161	0.0	2917	1426	1.000	1.000	NPHP4_HUMAN Nephrocystin-4 OS=Homo sapiens OX=9606 GN=NPHP4 PE=1 SV=2
4	P59240	0.0	2278	1425	0.784	0.785	NPHP4_MOUSE Nephrocystin-4 OS=Mus musculus OX=10090 GN=Nphp4 PE=1 SV=2
5	Q32Q04	0.0	830	530	0.279	0.751	Q32Q04_RAT Nphp4 protein OS=Rattus norvegicus OX=10116 GN=Nphp4 PE=2 SV=1
6	G5ECP0	8.00e-42	170	1305	0.142	0.155	G5ECP0_CAEEL NePHronoPhthisis (Human kidney disease) homolog OS=Caenorhabditis elegans OX=6239 GN=nphp-4 PE=2 SV=1
7	Q57ZA4	0.022	42.0	1352	0.033	0.035	Q57ZA4_TRYB2 Nephrocystin-4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.30P12.1070 PE=4 SV=1
8	Q9VSI3	0.64	37.0	740	0.023	0.045	Q9VSI3_DROME CUB and LDLa domain, isoform B OS=Drosophila melanogaster OX=7227 GN=Culd PE=4 SV=2
9	Q8IQA8	0.65	37.0	684	0.023	0.048	Q8IQA8_DROME CUB and LDLa domain, isoform C OS=Drosophila melanogaster OX=7227 GN=Culd PE=4 SV=1
10	Q8IQA9	0.70	37.0	965	0.023	0.034	Q8IQA9_DROME CUB and LDLa domain, isoform A OS=Drosophila melanogaster OX=7227 GN=Culd PE=4 SV=1
11	Q9L9F9	1.4	35.4	407	0.025	0.088	NOVI_STRNV Cytochrome P450 NovI OS=Streptomyces niveus OX=193462 GN=novI PE=3 SV=1
12	Q9NPG1	1.4	35.8	666	0.029	0.063	FZD3_HUMAN Frizzled-3 OS=Homo sapiens OX=9606 GN=FZD3 PE=1 SV=1
13	G4SLH0	1.6	35.8	18562	0.038	0.003	TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans OX=6239 GN=ttn-1 PE=1 SV=2
14	A2ARZ3	1.8	35.8	6995	0.029	0.006	FSIP2_MOUSE Fibrous sheath-interacting protein 2 OS=Mus musculus OX=10090 GN=Fsip2 PE=1 SV=3
15	O88563	3.5	34.7	1522	0.025	0.024	MRP3_RAT ATP-binding cassette sub-family C member 3 OS=Rattus norvegicus OX=10116 GN=Abcc3 PE=1 SV=1
16	P35900	3.8	34.3	424	0.020	0.066	K1C20_HUMAN Keratin, type I cytoskeletal 20 OS=Homo sapiens OX=9606 GN=KRT20 PE=1 SV=1
17	A8JNN6	4.4	33.1	181	0.020	0.155	A8JNN6_DROME CUB and LDLa domain, isoform E OS=Drosophila melanogaster OX=7227 GN=Culd PE=4 SV=1
18	Q5HNV1	4.7	33.5	269	0.013	0.067	AROE_STAEQ Shikimate dehydrogenase (NADP(+)) OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=aroE PE=1 SV=1
19	Q9HAP2	5.9	33.9	919	0.015	0.023	MLXIP_HUMAN MLX-interacting protein OS=Homo sapiens OX=9606 GN=MLXIP PE=1 SV=2
20	Q61086	6.4	33.5	666	0.029	0.062	FZD3_MOUSE Frizzled-3 OS=Mus musculus OX=10090 GN=Fzd3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367398

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000313169	0.999	Nephrocystin-1
2	9606.ENSP00000369257	0.999	Protein fantom
3	9606.ENSP00000367766	0.995	X-linked retinitis pigmentosa GTPase regulator
4	9606.ENSP00000382895	0.981	X-linked retinitis pigmentosa GTPase regulator-interacting protein 1
5	9606.ENSP00000338766	0.919	Nephrocystin-3
6	9606.ENSP00000448012	0.914	Centrosomal protein of 290 kDa
7	9606.ENSP00000389998	0.876	Meckelin
8	9606.ENSP00000243578	0.871	B9 domain-containing protein 2
9	9606.ENSP00000261499	0.868	B9 domain-containing protein 1
10	9606.ENSP00000262457	0.862	Inversin
11	9606.ENSP00000437550	0.852	Serine/threonine-protein kinase LATS1
12	9606.ENSP00000238616	0.842	Serine/threonine-protein kinase Nek9
13	9606.ENSP00000258173	0.841	Transmembrane protein 231
14	9606.ENSP00000376827	0.840	Meckel syndrome type 1 protein
15	9606.ENSP00000355499	0.839	Serologically defined colon cancer antigen 8
16	9606.ENSP00000261681	0.838	MAGUK p55 subfamily member 5
17	9606.ENSP00000268766	0.835	Serine/threonine-protein kinase Nek8
18	9606.ENSP00000403465	0.833	Coiled-coil and C2 domain-containing protein 2A
19	9606.ENSP00000356774	0.813	Jouberin
20	9606.ENSP00000226319	0.810	Protein Jade-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.975	biological regulation
GO:0050794	0.972	regulation of cellular process
GO:0009987	0.882	cellular process
GO:0048519	0.871	negative regulation of biological process
GO:0030111	0.870	regulation of Wnt signaling pathway
GO:0048523	0.840	negative regulation of cellular process
GO:0048522	0.815	positive regulation of cellular process
GO:0030178	0.776	negative regulation of Wnt signaling pathway
GO:0060828	0.738	regulation of canonical Wnt signaling pathway
GO:0044087	0.695	regulation of cellular component biogenesis
GO:0071840	0.611	cellular component organization or biogenesis
GO:0090090	0.567	negative regulation of canonical Wnt signaling pathway
GO:0016043	0.566	cellular component organization
GO:0051128	0.523	regulation of cellular component organization
GO:0032501	0.443	multicellular organismal process
GO:0044089	0.392	positive regulation of cellular component biogenesis
GO:0120036	0.315	plasma membrane bounded cell projection organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005815	1.000	microtubule organizing center
GO:0031981	0.995	nuclear lumen
GO:0005829	0.994	cytosol
GO:0005654	0.993	nucleoplasm
GO:0005813	0.958	centrosome
GO:0005929	0.947	cilium
GO:0030054	0.869	cell junction
GO:0070161	0.741	anchoring junction
GO:0005911	0.628	cell-cell junction
GO:0016604	0.490	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]