StarFunc result for job id O75164

User Input

>input (1064 residues)
MASESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYD
DIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERK
YWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGM
WKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRH
KMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYG
KQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLKESELP
PRAGNEEECPEEDMEGVEDGEEGDLKTSLAKHRIGTKRHRVCLEIPQEVSQSELFPKEDL
SSEQYEMTECPAALAPVRPTHSSVRQVEDGLTFPDYSDSTEVKFEELKNVKLEEEDEEEE
QAAAALDLSVNPASVGGRLVFSGSKKKSSSSLGSGSSRDSISSDSETSEPLSCRAQGQTG
VLTVHSYAKGDGRVTVGEPCTRKKGSAARSFSERELAEVADEYMFSLEENKKSKGRRQPL
SKLPRHHPLVLQECVSDDETSEQLTPEEEAEETEAWAKPLSQLWQNRPPNFEAEKEFNET
MAQQAPHCAVCMIFQTYHQVEFGGFNQNCGNASDLAPQKQRTKPLIPEMCFTSTGCSTDI
NLSTPYLEEDGTSILVSCKKCSVRVHASCYGVPPAKASEDWMCSRCSANALEEDCCLCSL
RGGALQRANDDRWVHVSCAVAILEARFVNIAERSPVDVSKIPLPRFKLKCIFCKKRRKRT
AGCCVQCSHGRCPTAFHVSCAQAAGVMMQPDDWPFVVFITCFRHKIPNLERAKGALQSIT
AGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEG
EVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELPKRVKSRLSV
ASDMRFNEIFTEKEVKQEKKRQRVINSRYREDYIEPALYRAIME

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0C4DFL8	0.337	0.329	0.000	1096	0.512	0.497	A0A0C4DFL8.pdb.gz	A0A0C4DFL8_HUMAN [histone H3]-trimethyl-L-lysine(9) demethylase OS=Homo sapiens OX=9606 GN=KDM4B PE=1 SV=1
2	AFDB:A0A2R8QE74	0.334	0.362	0.000	982	0.568	0.615	A0A2R8QE74.pdb.gz
3	AFDB:F1QNG0	0.490	0.498	0.000	1045	0.614	0.625	F1QNG0.pdb.gz	F1QNG0_DANRE [histone H3]-trimethyl-L-lysine(9) demethylase OS=Danio rerio OX=7955 GN=kdm4ab PE=3 SV=2
4	AFDB:F1QPD2	0.610	0.449	0.000	1482	0.530	0.381	F1QPD2.pdb.gz
5	AFDB:F5GX28	0.327	0.308	0.000	1130	0.513	0.483	F5GX28.pdb.gz	F5GX28_HUMAN [histone H3]-trimethyl-L-lysine(9) demethylase OS=Homo sapiens OX=9606 GN=KDM4B PE=1 SV=2
6	AFDB:M0RB75	0.541	0.526	0.000	1099	0.516	0.500	M0RB75.pdb.gz	M0RB75_RAT [histone H3]-trimethyl-L-lysine(9) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm4b PE=3 SV=1
7	AFDB:O75164	1.000	1.000	0.000	1064	1.000	1.000	O75164.pdb.gz	KDM4A_HUMAN Lysine-specific demethylase 4A OS=Homo sapiens OX=9606 GN=KDM4A PE=1 SV=2
8	AFDB:Q8VCD7	0.338	0.341	0.000	1054	0.530	0.535	Q8VCD7.pdb.gz	KDM4C_MOUSE Lysine-specific demethylase 4C OS=Mus musculus OX=10090 GN=Kdm4c PE=1 SV=1
9	AFDB:Q9H3R0	0.543	0.546	0.000	1056	0.541	0.545	Q9H3R0.pdb.gz	KDM4C_HUMAN Lysine-specific demethylase 4C OS=Homo sapiens OX=9606 GN=KDM4C PE=1 SV=2
10	AFDB:Q3U2K5	0.325	0.672	1.112E-56	510	0.250	0.522	Q3U2K5.pdb.gz	KDM4D_MOUSE Lysine-specific demethylase 4D OS=Mus musculus OX=10090 GN=Kdm4d PE=2 SV=2
11	PDB:7yxgA	0.155	0.452	4.017E-7	313	0.045	0.153	7yxgA.pdb.gz	Conservation of the unusual dimeric JmjC fold of JMJD7 from Drosophila melanogaster to humans.
12	PDB:3al5B	0.165	0.480	8.537E-7	311	0.035	0.119	3al5B.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
13	PDB:3al5C	0.147	0.454	1.814E-6	284	0.026	0.099	3al5C.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
14	PDB:4qszA	0.149	0.218	1.131E-5	686	0.028	0.044	4qszA.pdb.gz	Crystal structure of mouse JMJd7 fused with maltose-binding protein
15	PDB:4b7eA	0.155	0.400	2.278E-5	349	0.035	0.106	4b7eA.pdb.gz	Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
16	PDB:5nfnB	0.150	0.410	3.902E-5	318	0.024	0.082	5nfnB.pdb.gz	(3S)-Lysyl hydroxylation of TRAFAC GTPases is catalyzed by the human Jumonji-C oxygenase JMJD7.
17	PDB:4cclB	0.121	0.300	1.292E-3	372	0.033	0.094	4cclB.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
18	PDB:2fdjA	0.074	0.314	2.896E-3	207	0.011	0.058	2fdjA.pdb.gz	Crystal structures of catalytic complexes of the oxidative DNA/RNA repair enzyme AlkB.
19	PDB:4bu2A	0.079	0.192	3.225E-3	379	0.019	0.053	4bu2A.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
20	PDB:6imcD	0.084	0.217	3.404E-3	340	0.020	0.062	6imcD.pdb.gz	Mammalian ALKBH1 serves as an N6-mA demethylase of unpairing DNA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DFL8	0.0	623	1096	0.258	0.250	A0A0C4DFL8_HUMAN [histone H3]-trimethyl-L-lysine(9) demethylase OS=Homo sapiens OX=9606 GN=KDM4B PE=1 SV=1
2	A0A0G2JXG2	0.0	621	1086	0.258	0.253	A0A0G2JXG2_RAT [histone H3]-trimethyl-L-lysine(9) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm4b PE=3 SV=2
3	A0A0G2K5I7	0.0	1986	1062	0.933	0.935	A0A0G2K5I7_RAT [histone H3]-trimethyl-L-lysine(9) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm4a PE=3 SV=1
4	A0A8I5ZWQ3	0.0	620	1055	0.258	0.261	A0A8I5ZWQ3_RAT [histone H3]-trimethyl-L-lysine(9) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm4b PE=3 SV=1
5	A0A8I6A3B2	0.0	1045	978	0.491	0.534	A0A8I6A3B2_RAT Lysine demethylase 4C OS=Rattus norvegicus OX=10116 GN=Kdm4c PE=4 SV=1
6	A0A8I6A8Y8	0.0	558	1009	0.235	0.248	A0A8I6A8Y8_RAT [histone H3]-trimethyl-L-lysine(9) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm4c PE=3 SV=1
7	A0A8I6GK41	0.0	622	1021	0.258	0.269	A0A8I6GK41_RAT [histone H3]-trimethyl-L-lysine(9) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm4b PE=3 SV=1
8	A2RRT0	0.0	607	1482	0.247	0.177	A2RRT0_DANRE [histone H3]-trimethyl-L-lysine(9) demethylase OS=Danio rerio OX=7955 GN=wu:fd55d07 PE=2 SV=1
9	D4A2N4	0.0	1796	971	0.849	0.930	D4A2N4_RAT Lysine demethylase 4A OS=Rattus norvegicus OX=10116 GN=Kdm4a PE=4 SV=1
10	F1LS62	0.0	1149	1050	0.537	0.544	F1LS62_RAT [histone H3]-trimethyl-L-lysine(9) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm4c PE=3 SV=4
11	F1QNG0	0.0	1318	1045	0.633	0.644	F1QNG0_DANRE [histone H3]-trimethyl-L-lysine(9) demethylase OS=Danio rerio OX=7955 GN=kdm4ab PE=3 SV=2
12	F5GX28	0.0	623	1130	0.258	0.242	F5GX28_HUMAN [histone H3]-trimethyl-L-lysine(9) demethylase OS=Homo sapiens OX=9606 GN=KDM4B PE=1 SV=2
13	M0RB75	0.0	622	1099	0.258	0.250	M0RB75_RAT [histone H3]-trimethyl-L-lysine(9) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm4b PE=3 SV=1
14	O75164	0.0	2224	1064	1.000	1.000	KDM4A_HUMAN Lysine-specific demethylase 4A OS=Homo sapiens OX=9606 GN=KDM4A PE=1 SV=2
15	O94953	0.0	623	1096	0.258	0.250	KDM4B_HUMAN Lysine-specific demethylase 4B OS=Homo sapiens OX=9606 GN=KDM4B PE=1 SV=4
16	Q8BW72	0.0	1993	1064	0.936	0.936	KDM4A_MOUSE Lysine-specific demethylase 4A OS=Mus musculus OX=10090 GN=Kdm4a PE=1 SV=3
17	Q8VCD7	0.0	561	1054	0.236	0.238	KDM4C_MOUSE Lysine-specific demethylase 4C OS=Mus musculus OX=10090 GN=Kdm4c PE=1 SV=1
18	Q91VY5	0.0	622	1086	0.259	0.254	KDM4B_MOUSE Lysine-specific demethylase 4B OS=Mus musculus OX=10090 GN=Kdm4b PE=2 SV=1
19	Q9H3R0	0.0	1163	1056	0.558	0.562	KDM4C_HUMAN Lysine-specific demethylase 4C OS=Homo sapiens OX=9606 GN=KDM4C PE=1 SV=2
20	Q3U2K5	9.47e-176	525	510	0.215	0.449	KDM4D_MOUSE Lysine-specific demethylase 4D OS=Mus musculus OX=10090 GN=Kdm4d PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09038 53-BP1_Tudor	86	14.5	Tumour suppressor p53-binding protein-1 Tudor
2	PF02373 JmjC	2.1e-39	145.9	JmjC domain, hydroxylase
3	PF02375 JmjN	1.2e-10	52.3	jmjN domain
4	PF09465 LBR_tudor	1.7e+02	13.4	Lamin-B receptor of TUDOR domain
5	PF00628 PHD	0.00054	31.1	PHD-finger
6	PF13831 PHD_2	1.1e-11	55.3	PHD-finger
7	PF08605 Rad9_Rad53_bind	2.3e+02	13.4	Fungal Rad9-like Rad53-binding
8	PF18104 Tudor_2	5.3e-30	114.1	Jumonji domain-containing protein 2A Tudor domain
9	PF18115 Tudor_3	1.9e+02	13.3	DNA repair protein Crb2 Tudor domain
10	PF18359 Tudor_5	1.7e+02	13.4	Histone methyltransferase Tudor domain 1
11	PF13771 zf-HC5HC2H	3.7e-11	54.4	PHD-like zinc-binding domain
12	PF13832 zf-HC5HC2H_2	2.6e-30	116.2	PHD-zinc-finger like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361473

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000268712	0.982	Nuclear receptor corepressor 1
2	9606.ENSP00000476960	0.976	Histone cluster 2 H3 pseudogene 2
3	9606.ENSP00000355657	0.974	Histone H3.1t
4	9606.ENSP00000367034	0.969	Histone cluster 1 H4 family member c
5	9606.ENSP00000159111	0.965	Lysine-specific demethylase 4B
6	9606.ENSP00000254810	0.950	H3 histone, family 3B (H3.3B)
7	9606.ENSP00000480826	0.948	Histone cluster 1 H3 family member a
8	9606.ENSP00000383042	0.943	Lysine-specific histone demethylase 1A
9	9606.ENSP00000244537	0.922	Histone cluster 1 H4 family member f
10	9606.ENSP00000386660	0.915	Lysine-specific demethylase 3A
11	9606.ENSP00000352252	0.913	Histone cluster 1 H3 family member j
12	9606.ENSP00000348056	0.906	SUMO-conjugating enzyme UBC9
13	9606.ENSP00000354995	0.906	ATP-binding cassette sub-family G member 1
14	9606.ENSP00000272317	0.902	Ubiquitin-40S ribosomal protein S27a
15	9606.ENSP00000304697	0.902	Polyubiquitin-B
16	9606.ENSP00000347168	0.902	Histone cluster 1 H4 family member j
17	9606.ENSP00000366956	0.902	Histone cluster 1 H4 family member h
18	9606.ENSP00000366974	0.902	Histone cluster 1 H4 family member b
19	9606.ENSP00000388107	0.902	Ubiquitin-60S ribosomal protein L40
20	9606.ENSP00000441543	0.902	Polyubiquitin-C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016706	1.000	2-oxoglutarate-dependent dioxygenase activity
GO:0032454	1.000	histone H3K9 demethylase activity
GO:0005515	0.999	protein binding
GO:0043169	0.995	cation binding
GO:0008270	0.993	zinc ion binding
GO:0019899	0.991	enzyme binding
GO:0042393	0.982	histone binding
GO:0140034	0.975	methylation-dependent protein binding
GO:0035064	0.954	methylated histone binding
GO:0051864	0.830	histone H3K36 demethylase activity
GO:0140684	0.801	histone H3K9me2/H3K9me3 demethylase activity
GO:0031625	0.757	ubiquitin protein ligase binding
GO:0008134	0.672	transcription factor binding
GO:0140297	0.636	DNA-binding transcription factor binding
GO:0016922	0.469	nuclear receptor binding
GO:0050681	0.362	nuclear androgen receptor binding
GO:0003682	0.347	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0048519	0.949	negative regulation of biological process
GO:0010468	0.946	regulation of gene expression
GO:0031323	0.941	regulation of cellular metabolic process
GO:0048523	0.917	negative regulation of cellular process
GO:0080090	0.870	regulation of primary metabolic process
GO:0051171	0.870	regulation of nitrogen compound metabolic process
GO:0050896	0.859	response to stimulus
GO:0019219	0.828	regulation of nucleobase-containing compound metabolic process
GO:0048518	0.822	positive regulation of biological process
GO:0009889	0.763	regulation of biosynthetic process
GO:0032501	0.760	multicellular organismal process
GO:0031326	0.746	regulation of cellular biosynthetic process
GO:0009892	0.741	negative regulation of metabolic process
GO:0051252	0.734	regulation of RNA metabolic process
GO:0010556	0.732	regulation of macromolecule biosynthetic process
GO:0048522	0.725	positive regulation of cellular process
GO:0045934	0.643	negative regulation of nucleobase-containing compound metabolic process
GO:2001141	0.637	regulation of RNA biosynthetic process
GO:0010605	0.636	negative regulation of macromolecule metabolic process
GO:0009893	0.634	positive regulation of metabolic process
GO:0009987	0.632	cellular process
GO:0050793	0.631	regulation of developmental process
GO:1903506	0.619	regulation of nucleic acid-templated transcription
GO:0006355	0.614	regulation of DNA-templated transcription
GO:0010604	0.596	positive regulation of macromolecule metabolic process
GO:0051253	0.589	negative regulation of RNA metabolic process
GO:0045595	0.566	regulation of cell differentiation
GO:0009890	0.445	negative regulation of biosynthetic process
GO:1903507	0.426	negative regulation of nucleic acid-templated transcription
GO:0045892	0.424	negative regulation of DNA-templated transcription
GO:0009894	0.422	regulation of catabolic process
GO:0006950	0.406	response to stress
GO:0008152	0.330	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.996	cytoplasm
GO:0043232	0.981	intracellular non-membrane-bounded organelle
GO:0031981	0.969	nuclear lumen
GO:0005654	0.939	nucleoplasm
GO:0005694	0.889	chromosome
GO:0000785	0.882	chromatin
GO:0005829	0.517	cytosol
GO:0032991	0.463	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.11.-	1.000	With 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors.
RHEA:60200	0.801	2 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(9)-[histone H3] + 2 O2 = 2 CO2 + 2 formaldehyde + N(6)-methyl-L-lysyl(9)-[histone H3] + 2 succinate
EC:1.14.11.66	0.801	[histone H3]-trimethyl-L-lysine(9) demethylase.

[back to server]