StarFunc result for job id O75165

User Input

>input (2243 residues)
MNIIRENKDLACFYTTKHSWRGKYKRVFSVGTHAITTYNPNTLEVTNQWPYGDICSISPV
GKGQGTEFNLTFRKGSGKKSETLKFSTEHRTELLTEALRFRTDFSEGKITGRRYNCYKHH
WSDSRKPVILEVTPGGFDQINPATNRVLCSYDYRNIEGFVDLSDYQGGFCILYGGFSRLH
LFASEQREEIIKSAIDHAGNYIGISLRIRKEPLEFEQYLNLRFGKYSTDESITSLAEFVV
QKISPRHSEPVKRVLALTETCLVERDPATYNIATLKPLGEVFALVCDSENPQLFTIEFIK
GQVRKYSSTERDSLLASLLDGVRASGNRDVCVKMTPTHKGQRWGLLSMPVDEEVESLHLR
FLATPPNGNFADAVFRFNANISYSGVLHAVTQDGLFSENKEKLINNAITALLSQEGDVVA
SNAELESQFQAVRRLVASKAGFLAFTQLPKFRERLGVKVVKALKRSNNGIIHAAVDMLCA
LMCPMHDDYDLRQEQLNKASLLSSKKFLENLLEKFNSHVDHGTGALVISSLLDFLTFALC
APYSETTEGQQFDMLLEMVASNGRTLFKLFQHPSMAIIKGAGLVMKAIIEEGDKEIATKM
QELALSEGALPRHLHTAMFTISSDQRMLTNRQLSRHLVGLWTADNATATNLLKRILPPGL
LAYLESSDLVPEKDADRMHVRDNVKIAMDQYGKFNKVPEWQRLAGKAAKEVEKFAKEKVD
LVLMHWRDRMGIAQKENINQKPVVLRKRRQRIKIEANWDLFYYRFGQDHARSNLIWNFKT
REELKDTLESEMRAFNIDRELGSANVISWNHHEFEVKYECLAEEIKIGDYYLRLLLEEDE
NEESGSIKRSYEFFNELYHRFLLTPKVNMKCLCLQALAIVYGRCHEEIGPFTDTRYIIGM
LERCTDKLERDRLILFLNKLILNKKNVKDLMDSNGIRILVDLLTLAHLHVSRATVPLQSN
VIEAAPDMKRESEKEWYFGNADKERSGPYGFHEMQELWTKGMLNAKTRCWAQGMDGWRPL
QSIPQLKWCLLASGQAVLNETDLATLILNMLITMCGYFPSRDQDNAIIRPLPKVKRLLSD
STCLPHIIQLLLTFDPILVEKVAILLYHIMQDNPQLPRLYLSGVFFFIMMYTGSNVLPVA
RFLKYTHTKQAFKSEETKGQDIFQRSILGHILPEAMVCYLENYEPEKFSEIFLGEFDTPE
AIWSSEMRRLMIEKIAAHLADFTPRLQSNTRALYQYCPIPIINYPQLENELFCNIYYLKQ
LCDTLRFPDWPIKDPVKLLKDTLDAWKKEVEKKPPMMSIDDAYEVLNLPQGQGPHDESKI
RKAYFRLAQKYHPDKNPEGRDMFEKVNKAYEFLCTKSAKIVDGPDPENIILILKTQSILF
NRHKEDLQPYKYAGYPMLIRTITMETSDDLLFSKESPLLPAATELAFHTVNCSALNAEEL
RRENGLEVLQEAFSRCVAVLTRASKPSDMSVQVCGYISKCYSVAAQFEECREKITEMPSI
IKDLCRVLYFGKSIPRVAALGVECVSSFAVDFWLQTHLFQAGILWYLLGFLFNYDYTLEE
SGIQKSEETNQQEVANSLAKLSVHALSRLGGYLAEEQATPENPTIRKSLAGMLTPYVARK
LAVASVTEILKMLNSNTESPYLIWNNSTRAELLEFLESQQENMIKKGDCDKTYGSEFVYS
DHAKELIVGEIFVRVYNEVPTFQLEVPKAFAASLLDYIGSQAQYLHTFMAITHAAKVESE
QHGDRLPRVEMALEALRNVIKYNPGSESECIGHFKLIFSLLRVHGAGQVQQLALEVVNIV
TSNQDCVNNIAESMVLSSLLALLHSLPSSRQLVLETLYALTSSTKIIKEAMAKGALIYLL
DMFCNSTHPQVRAQTAELFAKMTADKLIGPKVRITLMKFLPSVFMDAMRDNPEAAVHIFE
GTHENPELIWNDNSRDKVSTTVREMMLEHFKNQQDNPEANWKLPEDFAVVFGEAEGELAV
GGVFLRIFIAQPAWVLRKPREFLIALLEKLTELLEKNNPHGETLETLTMATVCLFSAQPQ
LADQVPPLGHLPKVIQAMNHRNNAIPKSAIRVIHALSENELCVRAMASLETIGPLMNGMK
KRADTVGLACEAINRMFQKEQSELVAQALKADLVPYLLKLLEGIGLENLDSPAATKAQIV
KALKAMTRSLQYGEQVNEILCRSSVWSAFKDQKHDLFISESQTAGYLTGPGVAGYLTAGT
STSVMSNLPPPVDHEAGDLGYQT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A1Z7S0	0.355	0.331	0.000	2408	0.499	0.465	A1Z7S0.pdb.gz	A1Z7S0_DROME Receptor mediated endocytosis 8, isoform A OS=Drosophila melanogaster OX=7227 GN=Rme-8 PE=1 SV=1
2	AFDB:F4IVL6	0.486	0.433	0.000	2554	0.321	0.282	F4IVL6.pdb.gz	GRV2_ARATH DnaJ homolog subfamily C GRV2 OS=Arabidopsis thaliana OX=3702 GN=GRV2 PE=1 SV=1
3	AFDB:G5ED36	0.611	0.602	0.000	2279	0.455	0.448	G5ED36.pdb.gz	G5ED36_CAEEL Endocytosis protein RME-8 OS=Caenorhabditis elegans OX=6239 GN=rme-8 PE=1 SV=1
4	AFDB:O75165	1.000	1.000	0.000	2243	1.000	1.000	O75165.pdb.gz	DJC13_HUMAN DnaJ homolog subfamily C member 13 OS=Homo sapiens OX=9606 GN=DNAJC13 PE=1 SV=5
5	AFDB:F4I718	0.117	0.121	1.440E-11	2136	0.109	0.115	F4I718.pdb.gz	CSI3_ARATH Protein CELLULOSE SYNTHASE INTERACTIVE 3 OS=Arabidopsis thaliana OX=3702 GN=CSI3 PE=1 SV=1
6	PDB:7mqaSP	0.105	0.097	5.142E-8	2485	0.115	0.104	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
7	AFDB:Q54C50	0.093	0.098	7.922E-8	2043	0.095	0.105	Q54C50.pdb.gz	Q54C50_DICDI Armadillo-like helical domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DG1098 PE=4 SV=1
8	PDB:7qpgR	0.106	0.108	9.198E-8	2208	0.106	0.108	7qpgR.pdb.gz
9	AFDB:B0UX67	0.083	0.076	1.139E-7	2563	0.097	0.085	B0UX67.pdb.gz
10	AFDB:P42345	0.080	0.072	1.182E-7	2549	0.099	0.087	P42345.pdb.gz	MTOR_HUMAN Serine/threonine-protein kinase mTOR OS=Homo sapiens OX=9606 GN=MTOR PE=1 SV=1
11	PDB:7mqaLM	0.135	0.144	2.200E-7	2041	0.108	0.119	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	AFDB:Q9R0L4	0.089	0.143	2.726E-7	1273	0.092	0.162	Q9R0L4.pdb.gz	CAND2_RAT Cullin-associated NEDD8-dissociated protein 2 OS=Rattus norvegicus OX=10116 GN=Cand2 PE=1 SV=1
13	AFDB:Q9VKY2	0.086	0.138	2.826E-7	1248	0.071	0.128	Q9VKY2.pdb.gz	CAND1_DROME Cullin-associated NEDD8-dissociated protein 1 OS=Drosophila melanogaster OX=7227 GN=Cand1 PE=2 SV=1
14	PDB:6bcuA	0.099	0.100	7.299E-7	2204	0.090	0.092	6bcuA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
15	PDB:7mq8SP	0.103	0.111	8.140E-7	1993	0.108	0.121	7mq8SP.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:7jq9A	0.106	0.101	1.089E-6	2427	0.112	0.103	7jq9A.pdb.gz
17	PDB:7mq8LM	0.132	0.141	1.404E-6	2005	0.101	0.113	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:7otmA	0.089	0.071	1.947E-6	3656	0.109	0.067	7otmA.pdb.gz	Structural insights into inhibitor regulation of the DNA repair protein DNA-PKcs.
19	PDB:7sukSP	0.123	0.124	3.359E-6	2234	0.114	0.115	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
20	PDB:7nfeA	0.104	0.079	4.492E-6	3585	0.111	0.069	7nfeA.pdb.gz	Cryo-EM of NHEJ supercomplexes provides insights into DNA repair.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4LFW6	0.0	1732	2407	0.380	0.354	A0A0B4LFW6_DROME Receptor mediated endocytosis 8, isoform B OS=Drosophila melanogaster OX=7227 GN=Rme-8 PE=1 SV=1
2	A1Z7S0	0.0	1728	2408	0.380	0.354	A1Z7S0_DROME Receptor mediated endocytosis 8, isoform A OS=Drosophila melanogaster OX=7227 GN=Rme-8 PE=1 SV=1
3	B3KN02	0.0	1790	890	0.387	0.976	B3KN02_HUMAN (human) hypothetical protein OS=Homo sapiens OX=9606 PE=2 SV=1
4	F4IVL6	0.0	786	2554	0.238	0.209	GRV2_ARATH DnaJ homolog subfamily C GRV2 OS=Arabidopsis thaliana OX=3702 GN=GRV2 PE=1 SV=1
5	G5ED36	0.0	1924	2279	0.456	0.448	G5ED36_CAEEL Endocytosis protein RME-8 OS=Caenorhabditis elegans OX=6239 GN=rme-8 PE=1 SV=1
6	O62178	0.0	1930	2271	0.456	0.450	O62178_CAEEL J domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rme-8 PE=1 SV=3
7	O75165	0.0	4673	2243	1.000	1.000	DJC13_HUMAN DnaJ homolog subfamily C member 13 OS=Homo sapiens OX=9606 GN=DNAJC13 PE=1 SV=5
8	Q4GYE8	2.58e-06	55.1	491	0.012	0.053	Q4GYE8_TRYB2 Chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.4300 PE=4 SV=1
9	Q03751	2.72e-06	53.5	249	0.012	0.112	DNJC5_DROME DnaJ homolog subfamily C member 5 homolog OS=Drosophila melanogaster OX=7227 GN=Csp PE=1 SV=1
10	C9J2C4	6.74e-06	52.0	228	0.012	0.118	C9J2C4_HUMAN DnaJ heat shock protein family (Hsp40) member B6 (Fragment) OS=Homo sapiens OX=9606 GN=DNAJB6 PE=1 SV=1
11	E9PH18	1.46e-05	50.4	211	0.012	0.128	E9PH18_HUMAN DnaJ heat shock protein family (Hsp40) member B6 OS=Homo sapiens OX=9606 GN=DNAJB6 PE=1 SV=1
12	Q7Z6W7	1.74e-05	51.6	309	0.012	0.087	DNJB7_HUMAN DnaJ homolog subfamily B member 7 OS=Homo sapiens OX=9606 GN=DNAJB7 PE=2 SV=2
13	Q2QUP1	1.82e-05	51.6	309	0.012	0.087	DJC79_ORYSJ DnaJ protein ERDJ7 OS=Oryza sativa subsp. japonica OX=39947 GN=ERDJ7 PE=3 SV=1
14	O60884	2.04e-05	52.0	412	0.010	0.056	DNJA2_HUMAN DnaJ homolog subfamily A member 2 OS=Homo sapiens OX=9606 GN=DNAJA2 PE=1 SV=1
15	O75190	2.13e-05	51.2	326	0.012	0.083	DNJB6_HUMAN DnaJ homolog subfamily B member 6 OS=Homo sapiens OX=9606 GN=DNAJB6 PE=1 SV=2
16	O35824	2.18e-05	51.6	412	0.010	0.056	DNJA2_RAT DnaJ homolog subfamily A member 2 OS=Rattus norvegicus OX=10116 GN=Dnaja2 PE=1 SV=1
17	Q380Y9	2.55e-05	50.8	308	0.011	0.078	Q380Y9_TRYB2 Chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8750 PE=4 SV=1
18	O16303	2.63e-05	51.6	439	0.008	0.043	O16303_CAEEL DNaJ domain (Prokaryotic heat shock protein) OS=Caenorhabditis elegans OX=6239 GN=dnj-19 PE=1 SV=1
19	G3V6I5	3.12e-05	51.2	429	0.011	0.056	G3V6I5_RAT DnaJ heat shock protein family (Hsp40) member A3 OS=Rattus norvegicus OX=10116 GN=Dnaja3 PE=1 SV=2
20	Q2UZS7	3.13e-05	51.2	480	0.011	0.050	Q2UZS7_RAT Tid-1 long isoform OS=Rattus norvegicus OX=10116 GN=Dnaja3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04826 Arm_2	15	16.5	Armadillo-like
2	PF00226 DnaJ	2.3e-11	54.9	DnaJ domain
3	PF14237 GYF_2	3.2e-13	60.5	GYF domain 2
4	PF19432 RME-8_N	0	1320.4	DNAJ protein RME-8 N-terminal
5	PF17918 TetR_C_15	1.7e+02	14.3	Tetracyclin repressor-like, C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000260818

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261889	0.986	Sorting nexin-1
2	9606.ENSP00000299138	0.879	Vacuolar protein sorting-associated protein 35
3	9606.ENSP00000432083	0.841	Heat shock cognate 71 kDa protein
4	9606.ENSP00000480853	0.797	Vacuolar protein sorting-associated protein 29
5	9606.ENSP00000314499	0.789	Cyclin-G-associated kinase
6	9606.ENSP00000341364	0.779	Transmembrane protein 230
7	9606.ENSP00000360108	0.774	Putative tyrosine-protein phosphatase auxilin
8	9606.ENSP00000362480	0.770	Vacuolar protein sorting-associated protein 26A
9	9606.ENSP00000265062	0.728	Ras-related protein Rab-7a
10	9606.ENSP00000281187	0.692	Vacuolar protein sorting-associated protein 26B
11	9606.ENSP00000368831	0.652	Sorting nexin-2
12	9606.ENSP00000409667	0.637	Synaptojanin-1
13	9606.ENSP00000356107	0.636	Ras-related protein Rab-7L1
14	9606.ENSP00000298910	0.629	Leucine-rich repeat serine/threonine-protein kinase 2
15	9606.ENSP00000327214	0.619	Cation-transporting ATPase 13A2
16	9606.ENSP00000282633	0.601	WASH complex subunit 2A
17	9606.ENSP00000378812	0.595	Coiled-coil-helix-coiled-coil-helix domain-containing protein 2
18	9606.ENSP00000279281	0.592	Vacuolar protein sorting-associated protein 51 homolog
19	9606.ENSP00000272322	0.589	Vacuolar protein sorting-associated protein 54
20	9606.ENSP00000363482	0.588	WASH complex subunit 2C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0071840	0.959	cellular component organization or biogenesis
GO:0006996	0.939	organelle organization
GO:0016050	0.933	vesicle organization
GO:0032502	0.917	developmental process
GO:0032501	0.912	multicellular organismal process
GO:0032879	0.827	regulation of localization
GO:0060341	0.801	regulation of cellular localization
GO:0051179	0.795	localization
GO:0051234	0.770	establishment of localization
GO:0010256	0.763	endomembrane system organization
GO:0007032	0.742	endosome organization
GO:0006810	0.736	transport
GO:0032386	0.713	regulation of intracellular transport
GO:0001503	0.690	ossification
GO:1903649	0.634	regulation of cytoplasmic transport
GO:0016192	0.573	vesicle-mediated transport
GO:0051641	0.569	cellular localization
GO:0050896	0.424	response to stimulus
GO:0048518	0.413	positive regulation of biological process
GO:0048869	0.393	cellular developmental process
GO:0051649	0.393	establishment of localization in cell
GO:0030154	0.384	cell differentiation
GO:0048522	0.320	positive regulation of cellular process
GO:0046907	0.317	intracellular transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010008	0.998	endosome membrane
GO:0005769	0.996	early endosome
GO:0005829	0.994	cytosol
GO:0032991	0.992	protein-containing complex
GO:0005886	0.987	plasma membrane
GO:0005773	0.986	vacuole
GO:0005764	0.979	lysosome
GO:0005576	0.967	extracellular region
GO:0005774	0.936	vacuolar membrane
GO:0098852	0.890	lytic vacuole membrane
GO:0070062	0.887	extracellular exosome
GO:0005765	0.879	lysosomal membrane
GO:0099503	0.769	secretory vesicle
GO:0030141	0.726	secretory granule
GO:0005766	0.719	primary lysosome
GO:0030667	0.667	secretory granule membrane
GO:0031901	0.632	early endosome membrane
GO:0071203	0.542	WASH complex
GO:0042582	0.519	azurophil granule
GO:0070013	0.502	intracellular organelle lumen
GO:0035577	0.435	azurophil granule membrane
GO:0031981	0.336	nuclear lumen
GO:0005654	0.308	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]