StarFunc result for job id O75170

User Input

>input (966 residues)
MFWKFDLNTTSHVDKLLDKEHVTLQELMDEDDILQECKAQNQKLLDFLCRQQCMEELVSL
ITQDPPLDMEEKVRFKYPNTACELLTCDVPQISDRLGGDESLLSLLYDFLDHEPPLNPLL
ASFFSKTIGNLIARKTEQVITFLKKKDKFISLVLKHIGTSALMDLLLRLVSCVEPAGLRQ
DVLHWLNEEKVIQRLVELIHPSQDEDRQSNASQTLCDIVRLGRDQGSQLQEALEPDPLLT
ALESQDCVEQLLKNMFDGDRTESCLVSGTQVLLTLLETRRVGTEGLVDSFSQGLERSYAV
SSSVLHGIEPRLKDFHQLLLNPPKKKAILTTIGVLEEPLGNARLHGARLMAALLHTNTPS
INQELCRLNTMDLLLDLFFKYTWNNFLHFQVELCIAAILSHAAREERTEASGSESRVEPP
HENGNRSLETPQPAASLPDNTMVTHLFQKCCLVQRILEAWEANDHTQAAGGMRRGNMGHL
TRIANAVVQNLERGPVQTHISEVIRGLPADCRGRWESFVEETLTETNRRNTVDLVSTHHL
HSSSEDEDIEGAFPNELSLQQAFSDYQIQQMTANFVDQFGFNDEEFADQDDNINAPFDRI
AEINFNIDADEDSPSAALFEACCSDRIQPFDDDEDEDIWEDSDTRCAARVMARPRFGAPH
ASESCSKNGPERGGQDGKASLEAHRDAPGAGAPPAPGKKEAPPVEGDSEGAMWTAVFDEP
ANSTPTAPGVVRDVGSSVWAAGTSAPEEKGWAKFTDFQPFCCSESGPRCSSPVDTECSHA
EGSRSQGPEKASQASYFAVSPASPCAWNVCVTRKAPLLASDSSSSGGSHSEDGDQKAASA
MDAVSRGPGREAPPLPTVARTEEAVGRVGCADSRLLSPACPAPKEVTAAPAVAVPPEATV
AITTALSKAGPAIPTPAVSSALAVAVPLGPIMAVTAAPAMVATLGTVTKDGKTDAPPEGA
ALNGPV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75170	1.000	1.000	0.000	966	1.000	1.000	O75170.pdb.gz	PP6R2_HUMAN Serine/threonine-protein phosphatase 6 regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PPP6R2 PE=1 SV=2
2	AFDB:Q5H9R7	0.543	0.598	6.278E-56	873	0.437	0.483	Q5H9R7.pdb.gz	PP6R3_HUMAN Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3 PE=1 SV=2
3	AFDB:Q9UPN7	0.515	0.563	6.303E-54	881	0.407	0.446	Q9UPN7.pdb.gz	PP6R1_HUMAN Serine/threonine-protein phosphatase 6 regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PPP6R1 PE=1 SV=5
4	AFDB:E9PKF6	0.520	0.595	6.327E-52	838	0.423	0.488	E9PKF6.pdb.gz	E9PKF6_HUMAN Protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3 PE=1 SV=1
5	AFDB:A0A024R5F3	0.379	0.447	8.285E-45	793	0.393	0.479	A0A024R5F3.pdb.gz
6	AFDB:F4I6B2	0.464	0.549	9.965E-31	811	0.238	0.284	F4I6B2.pdb.gz	F4I6B2_ARATH SIT4 phosphatase-associated family protein OS=Arabidopsis thaliana OX=3702 GN=At1g30470 PE=1 SV=1
7	PDB:4tnmA	0.237	0.479	1.560E-5	407	0.063	0.150	4tnmA.pdb.gz
8	AFDB:Q6PR54	0.169	0.090	4.582E-5	2419	0.126	0.050	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
9	PDB:2z6gA	0.170	0.254	5.503E-5	550	0.085	0.149	2z6gA.pdb.gz
10	AFDB:E1C2U2	0.212	0.112	6.532E-5	2326	0.146	0.061	E1C2U2.pdb.gz	RIF1_CHICK Telomere-associated protein RIF1 OS=Gallus gallus OX=9031 GN=RIF1 PE=3 SV=3
11	AFDB:Q92540	0.102	0.092	1.179E-4	1137	0.119	0.101	Q92540.pdb.gz	SMG7_HUMAN Nonsense-mediated mRNA decay factor SMG7 OS=Homo sapiens OX=9606 GN=SMG7 PE=1 SV=2
12	PDB:3tpoA	0.243	0.455	1.658E-4	438	0.066	0.146	3tpoA.pdb.gz
13	PDB:6n1zA	0.186	0.187	2.272E-4	961	0.075	0.075	6n1zA.pdb.gz
14	PDB:4jlqA	0.116	0.126	2.660E-4	840	0.091	0.105	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
15	PDB:1wa5B	0.232	0.408	2.767E-4	466	0.063	0.131	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
16	PDB:7rroH7	0.123	0.176	2.878E-4	580	0.092	0.153	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
17	PDB:7nscE	0.121	0.169	3.239E-4	615	0.077	0.120	7nscE.pdb.gz
18	AFDB:O15550	0.114	0.088	3.554E-4	1401	0.146	0.101	O15550.pdb.gz	KDM6A_HUMAN Lysine-specific demethylase 6A OS=Homo sapiens OX=9606 GN=KDM6A PE=1 SV=2
19	PDB:7unkA	0.141	0.132	3.945E-4	1047	0.083	0.076	7unkA.pdb.gz
20	PDB:4r0zA	0.173	0.256	4.996E-4	557	0.072	0.126	4r0zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PKF6	0.0	750	838	0.431	0.496	E9PKF6_HUMAN Protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3 PE=1 SV=1
2	H7BXH2	0.0	725	827	0.422	0.493	H7BXH2_HUMAN Protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3 PE=1 SV=1
3	O75170	0.0	1986	966	1.000	1.000	PP6R2_HUMAN Serine/threonine-protein phosphatase 6 regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PPP6R2 PE=1 SV=2
4	Q5H9R7	0.0	802	873	0.453	0.502	PP6R3_HUMAN Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3 PE=1 SV=2
5	Q9UPN7	0.0	687	881	0.353	0.387	PP6R1_HUMAN Serine/threonine-protein phosphatase 6 regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PPP6R1 PE=1 SV=5
6	H0YEN2	2.04e-119	379	580	0.256	0.426	H0YEN2_HUMAN Protein phosphatase 6 regulatory subunit 3 (Fragment) OS=Homo sapiens OX=9606 GN=PPP6R3 PE=1 SV=1
7	E9PQP7	1.60e-117	375	641	0.242	0.365	E9PQP7_HUMAN Protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3 PE=1 SV=1
8	M9PEH8	8.27e-82	288	996	0.155	0.151	M9PEH8_DROME Fiery mountain, isoform D OS=Drosophila melanogaster OX=7227 GN=fmt PE=1 SV=1
9	F4I6B2	4.08e-71	254	811	0.179	0.213	F4I6B2_ARATH SIT4 phosphatase-associated family protein OS=Arabidopsis thaliana OX=3702 GN=At1g30470 PE=1 SV=1
10	O74511	6.82e-37	152	838	0.116	0.134	EKC1_SCHPO Extragenic suppressor of kinetochore protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ekc1 PE=1 SV=2
11	P40856	3.14e-16	86.3	1058	0.077	0.070	SA185_YEAST SIT4-associating protein SAP185 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SAP185 PE=1 SV=1
12	P36123	7.02e-16	85.1	1033	0.078	0.073	SA190_YEAST SIT4-associating protein SAP190 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SAP190 PE=1 SV=2
13	B2D6K9	2.79e-15	82.8	778	0.065	0.081	PPH6R_CAEEL Serine/threonine-protein phosphatase 6 regulatory subunit OS=Caenorhabditis elegans OX=6239 GN=saps-1 PE=1 SV=1
14	A0A1D8PR81	7.85e-11	68.6	861	0.075	0.084	A0A1D8PR81_CANAL Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SAP190 PE=3 SV=1
15	P43612	1.09e-04	48.5	1002	0.066	0.064	SA155_YEAST SIT4-associating protein SAP155 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SAP155 PE=1 SV=4
16	A0A509AHT1	1.34e-04	48.5	1057	0.025	0.023	A0A509AHT1_PLABA Protein SOC1 OS=Plasmodium berghei (strain Anka) OX=5823 GN=PBANKA_0720200 PE=3 SV=1
17	Q59QN2	0.004	43.9	924	0.031	0.032	Q59QN2_CANAL Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SAP155 PE=3 SV=1
18	A0A0A6YYJ5	0.52	36.6	1668	0.035	0.020	A0A0A6YYJ5_HUMAN Microtubule actin crosslinking factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=2
19	E9QAM5	1.2	35.4	2947	0.019	0.006	HELZ2_MOUSE Helicase with zinc finger domain 2 OS=Mus musculus OX=10090 GN=Helz2 PE=1 SV=1
20	Q62633	3.0	33.9	348	0.026	0.072	NTCP2_RAT Ileal sodium/bile acid cotransporter OS=Rattus norvegicus OX=10116 GN=Slc10a2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08216 CTNNBL	2.4e+02	11.5	Catenin-beta-like, Arm-motif containing nuclear
2	PF04499 SAPS	4.6e-113	390.2	SIT4 phosphatase-associated protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000012680

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000024849	0.957	Protein phosphatase 6, catalytic subunit
2	9593.ENSGGOP00000009342	0.888	Ankyrin repeat domain 28
3	9593.ENSGGOP00000023999	0.858	Ankyrin repeat domain 52
4	9593.ENSGGOP00000021755	0.782	Ankyrin repeat domain 44
5	9593.ENSGGOP00000024412	0.741	TOR signaling pathway regulator
6	9593.ENSGGOP00000009066	0.719	Splicing factor 3b, subunit 1, 155kDa
7	9593.ENSGGOP00000008704	0.701	NFKB inhibitor epsilon
8	9593.ENSGGOP00000000333	0.655	Protein phosphatase 2, catalytic subunit, alpha isozyme
9	9593.ENSGGOP00000014124	0.654	Microtubule associated tumor suppressor 1
10	9593.ENSGGOP00000006360	0.651	Centrosomal protein 170B
11	9593.ENSGGOP00000014927	0.648	GM2 ganglioside activator
12	9593.ENSGGOP00000013634	0.582	Protein phosphatase 2, catalytic subunit, beta isozyme
13	9593.ENSGGOP00000004914	0.557	HEAT repeat containing 5B
14	9593.ENSGGOP00000000316	0.545	Thyroid hormone receptor interactor 12
15	9593.ENSGGOP00000008443	0.535	Protein phosphatase 4, catalytic subunit
16	9593.ENSGGOP00000017808	0.533	Elongator complex protein 3
17	9593.ENSGGOP00000011295	0.527	Ankyrin repeat domain 50
18	9593.ENSGGOP00000021680	0.526	Solute carrier family 9, subfamily B (NHA2, cation proton antiporter 2), member 2
19	9593.ENSGGOP00000010079	0.525	Leukemia NUP98 fusion partner 1
20	9593.ENSGGOP00000026414	0.515	TERF2 interacting protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0019222	0.975	regulation of metabolic process
GO:0051336	0.967	regulation of hydrolase activity
GO:0031323	0.966	regulation of cellular metabolic process
GO:0051171	0.958	regulation of nitrogen compound metabolic process
GO:0080090	0.957	regulation of primary metabolic process
GO:0060255	0.957	regulation of macromolecule metabolic process
GO:0051174	0.957	regulation of phosphorus metabolic process
GO:0019220	0.951	regulation of phosphate metabolic process
GO:0051246	0.911	regulation of protein metabolic process
GO:0009987	0.742	cellular process
GO:0031399	0.674	regulation of protein modification process
GO:0043666	0.437	regulation of phosphoprotein phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0043233	0.868	organelle lumen
GO:0005634	0.667	nucleus
GO:0070013	0.619	intracellular organelle lumen
GO:0031981	0.606	nuclear lumen
GO:0005654	0.592	nucleoplasm
GO:0016020	0.449	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]