StarFunc result for job id O75173

User Input

>input (837 residues)
MSQTGSHPGRGLAGRWLWGAQPCLLLPIVPLSWLVWLLLLLLASLLPSARLASPLPREEE
IVFPEKLNGSVLPGSGAPARLLCRLQAFGETLLLELEQDSGVQVEGLTVQYLGQAPELLG
GAEPGTYLTGTINGDPESVASLHWDGGALLGVLQYRGAELHLQPLEGGTPNSAGGPGAHI
LRRKSPASGQGPMCNVKAPLGSPSPRPRRAKRFASLSRFVETLVVADDKMAAFHGAGLKR
YLLTVMAAAAKAFKHPSIRNPVSLVVTRLVILGSGEEGPQVGPSAAQTLRSFCAWQRGLN
TPEDSDPDHFDTAILFTRQDLCGVSTCDTLGMADVGTVCDPARSCAIVEDDGLQSAFTAA
HELGHVFNMLHDNSKPCISLNGPLSTSRHVMAPVMAHVDPEEPWSPCSARFITDFLDNGY
GHCLLDKPEAPLHLPVTFPGKDYDADRQCQLTFGPDSRHCPQLPPPCAALWCSGHLNGHA
MCQTKHSPWADGTPCGPAQACMGGRCLHMDQLQDFNIPQAGGWGPWGPWGDCSRTCGGGV
QFSSRDCTRPVPRNGGKYCEGRRTRFRSCNTEDCPTGSALTFREEQCAAYNHRTDLFKSF
PGPMDWVPRYTGVAPQDQCKLTCQAQALGYYYVLEPRVVDGTPCSPDSSSVCVQGRCIHA
GCDRIIGSKKKFDKCMVCGGDGSGCSKQSGSFRKFRYGYNNVVTIPAGATHILVRQQGNP
GHRSIYLALKLPDGSYALNGEYTLMPSPTDVVLPGAVSLRYSGATAASETLSGHGPLAQP
LTLQVLVAGNPQDTRLRYSFFVPRPTPSTPRPTPQDWLHRRAQILEILRRRPWAGRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BNJ2	0.906	0.910	0.000	833	0.901	0.905	Q8BNJ2.pdb.gz	ATS4_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 4 OS=Mus musculus OX=10090 GN=Adamts4 PE=2 SV=2
2	AFDB:Q9TT93	0.883	0.881	0.000	839	0.920	0.918	Q9TT93.pdb.gz	ATS4_BOVIN A disintegrin and metalloproteinase with thrombospondin motifs 4 OS=Bos taurus OX=9913 GN=ADAMTS4 PE=1 SV=3
3	AFDB:P97857	0.744	0.648	5.772E-102	968	0.487	0.421	P97857.pdb.gz	ATS1_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Mus musculus OX=10090 GN=Adamts1 PE=1 SV=4
4	AFDB:Q9UHI8	0.730	0.634	4.989E-100	967	0.477	0.413	Q9UHI8.pdb.gz	ATS1_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Homo sapiens OX=9606 GN=ADAMTS1 PE=1 SV=4
5	AFDB:P59384	0.793	0.704	7.035E-95	950	0.446	0.393	P59384.pdb.gz	ATS15_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 15 OS=Mus musculus OX=10090 GN=Adamts15 PE=1 SV=2
6	AFDB:Q9UP79	0.697	0.658	3.474E-90	889	0.435	0.409	Q9UP79.pdb.gz	ATS8_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 8 OS=Homo sapiens OX=9606 GN=ADAMTS8 PE=2 SV=2
7	AFDB:Q9R001	0.689	0.621	2.625E-84	930	0.389	0.351	Q9R001.pdb.gz	ATS5_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 5 OS=Mus musculus OX=10090 GN=Adamts5 PE=2 SV=2
8	AFDB:F1R6Q4	0.662	0.394	1.033E-82	1461	0.382	0.219	F1R6Q4.pdb.gz
9	AFDB:P59511	0.667	0.310	1.209E-82	1906	0.395	0.174	P59511.pdb.gz	ATS20_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Mus musculus OX=10090 GN=Adamts20 PE=2 SV=2
10	AFDB:Q9P2N4	0.653	0.298	5.834E-82	1935	0.380	0.164	Q9P2N4.pdb.gz	ATS9_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4
11	PDB:4q1lA	0.212	0.822	8.892E-11	202	0.066	0.272	4q1lA.pdb.gz	Complete amino-acid sequence, crystallization and preliminary X-ray diffraction studies of leucurolysin-a, a nonhaemorrhagic metalloproteinase from Bothrops leucurus snake venom.
12	PDB:7ufgB	0.168	0.125	2.010E-5	1182	0.131	0.093	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
13	PDB:2x7mA	0.155	0.590	4.416E-5	180	0.039	0.183	2x7mA.pdb.gz	Crystal Structure of Archaemetzincin Amza from Methanopyrus Kandleri at 1.5A Resolution.
14	PDB:7ufgA	0.175	0.135	7.463E-5	1151	0.130	0.095	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
15	PDB:1w0rA	0.067	0.122	7.506E-4	442	0.049	0.093	1w0rA.pdb.gz
16	PDB:4axqA	0.143	0.613	1.649E-3	163	0.032	0.166	4axqA.pdb.gz	Crystal Structures of Archaemetzincin Reveal a Moldable Substrate-Binding Site.
17	PDB:4kncB	0.091	0.167	9.814E-3	419	0.020	0.041	4kncB.pdb.gz
18	PDB:8a7eC	0.164	0.096	2.046E-2	1524	0.111	0.061	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
19	PDB:7nycC	0.053	0.055	2.272E-2	809	0.038	0.040	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
20	PDB:7nydE	0.071	0.115	2.802E-2	484	0.033	0.058	7nydE.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3V673	0.0	570	927	0.382	0.345	G3V673_RAT ADAM metallopeptidase with thrombospondin type 1 motif, 5 OS=Rattus norvegicus OX=10116 GN=Adamts5 PE=4 SV=1
2	O75173	0.0	1709	837	1.000	1.000	ATS4_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 4 OS=Homo sapiens OX=9606 GN=ADAMTS4 PE=1 SV=3
3	P59384	0.0	701	950	0.453	0.399	ATS15_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 15 OS=Mus musculus OX=10090 GN=Adamts15 PE=1 SV=2
4	P97857	0.0	793	968	0.479	0.414	ATS1_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Mus musculus OX=10090 GN=Adamts1 PE=1 SV=4
5	Q5VTW1	0.0	633	339	0.381	0.941	Q5VTW1_HUMAN ADAM metallopeptidase with thrombospondin type 1 motif 4 OS=Homo sapiens OX=9606 GN=ADAMTS4 PE=1 SV=1
6	Q6TY19	0.0	572	928	0.384	0.346	Q6TY19_RAT ADAMTS5 OS=Rattus norvegicus OX=10116 GN=Adamts5 PE=2 SV=1
7	Q8BNJ2	0.0	1470	833	0.904	0.909	ATS4_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 4 OS=Mus musculus OX=10090 GN=Adamts4 PE=2 SV=2
8	Q9ESP7	0.0	1156	630	0.693	0.921	ATS4_RAT A disintegrin and metalloproteinase with thrombospondin motifs 4 (Fragment) OS=Rattus norvegicus OX=10116 GN=Adamts4 PE=2 SV=2
9	Q9R001	0.0	573	930	0.385	0.346	ATS5_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 5 OS=Mus musculus OX=10090 GN=Adamts5 PE=2 SV=2
10	Q9TT93	0.0	1525	839	0.918	0.915	ATS4_BOVIN A disintegrin and metalloproteinase with thrombospondin motifs 4 OS=Bos taurus OX=9913 GN=ADAMTS4 PE=1 SV=3
11	Q9UHI8	0.0	784	967	0.491	0.425	ATS1_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Homo sapiens OX=9606 GN=ADAMTS1 PE=1 SV=4
12	Q9UNA0	0.0	566	930	0.384	0.345	ATS5_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 5 OS=Homo sapiens OX=9606 GN=ADAMTS5 PE=1 SV=2
13	Q9UP79	0.0	650	889	0.424	0.399	ATS8_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 8 OS=Homo sapiens OX=9606 GN=ADAMTS8 PE=2 SV=2
14	Q9WUQ1	0.0	799	967	0.493	0.427	ATS1_RAT A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Rattus norvegicus OX=10116 GN=Adamts1 PE=2 SV=1
15	P59511	2.21e-180	568	1906	0.401	0.176	ATS20_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Mus musculus OX=10090 GN=Adamts20 PE=2 SV=2
16	P59510	7.48e-173	548	1910	0.376	0.165	ATS20_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Homo sapiens OX=9606 GN=ADAMTS20 PE=2 SV=2
17	Q9P2N4	9.36e-173	548	1935	0.362	0.157	ATS9_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4
18	E9PUN6	6.36e-164	524	1931	0.323	0.140	E9PUN6_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
19	F1SFS3	5.14e-156	503	2000	0.317	0.133	F1SFS3_PIG ADAM metallopeptidase with thrombospondin type 1 motif 9 OS=Sus scrofa OX=9823 GN=ADAMTS9 PE=4 SV=5
20	Q19791	2.35e-145	475	2150	0.329	0.128	GON1_CAEEL A disintegrin and metalloproteinase with thrombospondin motifs gon-1 OS=Caenorhabditis elegans OX=6239 GN=gon-1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17771 ADAMTS_CR_2	3.7e-16	70.7	ADAMTS cysteine-rich domain 2
2	PF19236 ADAMTS_CR_3	0.00029	32.2	ADAMTS cysteine-rich domain
3	PF05986 ADAMTS_spacer1	9.3e-24	95.3	ADAM-TS Spacer 1
4	PF01562 Pep_M12B_propep	0.0012	30.6	Reprolysin family propeptide
5	PF01421 Reprolysin	9.9e-12	56.8	Reprolysin (M12B) family zinc metalloprotease
6	PF13574 Reprolysin_2	0.27	22.6	Metallo-peptidase family M12B Reprolysin-like
7	PF13582 Reprolysin_3	2.7e-05	36.1	Metallo-peptidase family M12B Reprolysin-like
8	PF13583 Reprolysin_4	14	16.8	Metallo-peptidase family M12B Reprolysin-like
9	PF13688 Reprolysin_5	7.6e-06	37.7	Metallo-peptidase family M12
10	PF19030 TSP1_ADAMTS	0.86	21.2	Thrombospondin type 1 domain
11	PF19028 TSP1_spondin	0.0039	28.8	Spondin-like TSP1 domain
12	PF00090 TSP_1	2e-05	36.0	Thrombospondin type 1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356975

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000387356	0.995	Aggrecan core protein
2	9606.ENSP00000331210	0.971	Brevican core protein
3	9606.ENSP00000483599	0.922	Spondin-2
4	9606.ENSP00000339613	0.921	GDP-fucose protein O-fucosyltransferase 2
5	9606.ENSP00000346478	0.920	ADAMTS-like protein 2
6	9606.ENSP00000260356	0.919	Thrombospondin-1
7	9606.ENSP00000343002	0.919	Beta-1,3-glucosyltransferase
8	9606.ENSP00000360997	0.919	A disintegrin and metalloproteinase with thrombospondin motifs 13
9	9606.ENSP00000358035	0.918	ADAMTS-like protein 4
10	9606.ENSP00000362304	0.917	A disintegrin and metalloproteinase with thrombospondin motifs 14
11	9606.ENSP00000373472	0.917	A disintegrin and metalloproteinase with thrombospondin motifs 7
12	9606.ENSP00000251582	0.916	A disintegrin and metalloproteinase with thrombospondin motifs 2
13	9606.ENSP00000268070	0.916	ADAM metallopeptidase with thrombospondin type 1 motif 17
14	9606.ENSP00000355751	0.916	Thrombospondin-2
15	9606.ENSP00000422554	0.916	A disintegrin and metalloproteinase with thrombospondin motifs 12
16	9606.ENSP00000460236	0.916	Spondin-1
17	9606.ENSP00000274181	0.915	ADAM metallopeptidase with thrombospondin type 1 motif 16
18	9606.ENSP00000274487	0.915	ADAM metallopeptidase with thrombospondin type 1 motif 19
19	9606.ENSP00000369921	0.915	ADAMTS-like protein 1
20	9606.ENSP00000370443	0.914	ADAM metallopeptidase with thrombospondin type 1 motif 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008237	0.999	metallopeptidase activity
GO:0004175	0.999	endopeptidase activity
GO:0005515	0.998	protein binding
GO:0004222	0.989	metalloendopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.984	cellular process
GO:0043170	0.980	macromolecule metabolic process
GO:1901564	0.980	organonitrogen compound metabolic process
GO:0019538	0.950	protein metabolic process
GO:0006508	0.937	proteolysis
GO:0022411	0.933	cellular component disassembly
GO:0045229	0.905	external encapsulating structure organization
GO:0043062	0.889	extracellular structure organization
GO:0032502	0.856	developmental process
GO:0048856	0.849	anatomical structure development
GO:0032501	0.833	multicellular organismal process
GO:0050896	0.690	response to stimulus
GO:0007275	0.638	multicellular organism development
GO:0030198	0.638	extracellular matrix organization
GO:0050789	0.538	regulation of biological process
GO:0022617	0.463	extracellular matrix disassembly
GO:0050794	0.450	regulation of cellular process
GO:0048731	0.385	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070013	0.998	intracellular organelle lumen
GO:0062023	0.997	collagen-containing extracellular matrix
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0005576	0.982	extracellular region
GO:0012505	0.945	endomembrane system
GO:0005615	0.856	extracellular space
GO:0005737	0.715	cytoplasm
GO:0005634	0.553	nucleus
GO:0031981	0.409	nuclear lumen
GO:0005654	0.389	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	0.999	Acting on peptide bonds (peptidases).
EC:3.4.24.-	0.989	Metalloendopeptidases.

[back to server]