StarFunc result for job id O75175

User Input

>input (753 residues)
MADKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNAANANQKEKYEADLKKEIKKLQRLRD
QIKTWVASNEIKDKRQLIDNRKLIETQMERFKVVERETKTKAYSKEGLGLAQKVDPAQKE
KEEVGQWLTNTIDTLNMQVDQFESEVESLSVQTRKKKGDKDKQDRIEGLKRHIEKHRYHV
RMLETILRMLDNDSILVDAIRKIKDDVEYYVDSSQDPDFEENEFLYDDLDLEDIPQALVA
TSPPSHSHMEDEIFNQSSSTPTSTTSSSPIPPSPANCTTENSEDDKKRGRSTDSEVSQSP
AKNGSKPVHSNQHPQSPAVPPTYPSGPPPAASALSTTPGNNGVPAPAAPPSALGPKASPA
PSHNSGTPAPYAQAVAPPAPSGPSTTQPRPPSVQPSGGGGGGSGGGGSSSSSNSSAGGGA
GKQNGATSYSSVVADSPAEVALSSSGGNNASSQALGPPSGPHNPPPSTSKEPSAAAPTGA
GGVAPGSGNNSGGPSLLVPLPVNPPSSPTPSFSDAKAAGALLNGPPQFSTAPEIKAPEPL
SSLKSMAERAAISSGIEDPVPTLHLTERDIILSSTSAPPASAQPPLQLSEVNIPLSLGVC
PLGPVPLTKEQLYQQAMEEAAWHHMPHPSDSERIRQYLPRNPCPTPPYHHQMPPPHSDTV
EFYQRLSTETLFFIFYYLEGTKAQYLAAKALKKQSWRFHTKYMMWFQRHEEPKTITDEFE
QGTYIYFDYEKWGQRKKEGFTFEYRYLEDRDLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75175	0.999	0.999	4.269E-95	753	1.000	1.000	O75175.pdb.gz	CNOT3_HUMAN CCR4-NOT transcription complex subunit 3 OS=Homo sapiens OX=9606 GN=CNOT3 PE=1 SV=1
2	AFDB:F1Q4L8	0.274	0.237	5.865E-62	908	0.704	0.584	F1Q4L8.pdb.gz	F1Q4L8_DANRE CCR4-NOT transcription complex subunit 3 OS=Danio rerio OX=7955 GN=cnot3 PE=3 SV=2
3	AFDB:Q642H1	0.290	0.342	1.555E-58	632	0.618	0.736	Q642H1.pdb.gz
4	AFDB:Q7K126	0.314	0.287	1.950E-47	844	0.449	0.400	Q7K126.pdb.gz	Q7K126_DROME CCR4-NOT transcription complex subunit 3, isoform A OS=Drosophila melanogaster OX=7227 GN=Not3 PE=1 SV=1
5	AFDB:G5EFX8	0.332	0.351	7.745E-38	701	0.353	0.379	G5EFX8.pdb.gz	G5EFX8_CAEEL Not3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ntl-3 PE=1 SV=1
6	AFDB:O13870	0.315	0.365	7.071E-34	640	0.311	0.366	O13870.pdb.gz	NOT3_SCHPO General negative regulator of transcription subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=not3 PE=1 SV=2
7	AFDB:F4JWJ7	0.199	0.183	1.531E-33	845	0.380	0.338	F4JWJ7.pdb.gz	F4JWJ7_ARATH Transcription regulator NOT2/NOT3/NOT5 family protein OS=Arabidopsis thaliana OX=3702 GN=NOT3 PE=1 SV=1
8	AFDB:A8MR45	0.145	0.176	1.672E-8	614	0.139	0.171	A8MR45.pdb.gz	A8MR45_ARATH NOT2 / NOT3 / NOT5 family OS=Arabidopsis thaliana OX=3702 GN=NOT2A PE=1 SV=1
9	PDB:4by6E	0.127	0.509	1.814E-6	168	0.056	0.250	4by6E.pdb.gz	Structure and RNA-Binding Properties of the not1-not2-not5 Module of the Yeast Ccr4-not Complex
10	AFDB:Q9VHC4	0.074	0.053	6.135E-4	1133	0.167	0.111	Q9VHC4.pdb.gz	Q9VHC4_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=FCHo2 PE=1 SV=3
11	AFDB:Q6S002	0.078	0.053	3.359E-3	1238	0.113	0.069	Q6S002.pdb.gz	KIF10_DICDI Kinesin-related protein 10 OS=Dictyostelium discoideum OX=44689 GN=kif10 PE=3 SV=1
12	PDB:3hajA	0.095	0.216	4.965E-1	286	0.039	0.101	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
13	PDB:3c98B	0.082	0.180	5.794E-1	230	0.053	0.174	3c98B.pdb.gz
14	PDB:7rroA0	0.095	0.299	1.255	221	0.035	0.118	7rroA0.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
15	PDB:4pw8F	0.070	0.149	1.624	303	0.035	0.086	4pw8F.pdb.gz
16	PDB:6lw5A	0.073	0.119	1.800	427	0.035	0.061	6lw5A.pdb.gz	Structural basis of ligand binding modes at the human formyl peptide receptor 2.
17	PDB:7ungB0	0.062	0.213	1.800	193	0.019	0.073	7ungB0.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
18	PDB:7ungC4	0.099	0.327	1.895	219	0.028	0.096	7ungC4.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
19	PDB:2b5uA	0.093	0.141	2.212	470	0.027	0.043	2b5uA.pdb.gz
20	PDB:5oobF	0.066	0.069	2.582	718	0.046	0.049	5oobF.pdb.gz	Structural basis for mutually exclusive co-transcriptional nuclear cap-binding complexes with either NELF-E or ARS2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75175	0.0	1544	753	1.000	1.000	CNOT3_HUMAN CCR4-NOT transcription complex subunit 3 OS=Homo sapiens OX=9606 GN=CNOT3 PE=1 SV=1
2	Q8K0V4	0.0	1286	751	0.950	0.952	CNOT3_MOUSE CCR4-NOT transcription complex subunit 3 OS=Mus musculus OX=10090 GN=Cnot3 PE=1 SV=1
3	E9QGK5	1.80e-169	513	901	0.363	0.303	E9QGK5_DANRE CCR4-NOT transcription complex subunit 3 isoform X2 OS=Danio rerio OX=7955 GN=cnot3 PE=3 SV=1
4	F1Q4L8	1.95e-169	513	908	0.363	0.301	F1Q4L8_DANRE CCR4-NOT transcription complex subunit 3 OS=Danio rerio OX=7955 GN=cnot3 PE=3 SV=2
5	Q7K126	2.24e-77	268	844	0.158	0.141	Q7K126_DROME CCR4-NOT transcription complex subunit 3, isoform A OS=Drosophila melanogaster OX=7227 GN=Not3 PE=1 SV=1
6	O13870	3.54e-67	236	640	0.149	0.175	NOT3_SCHPO General negative regulator of transcription subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=not3 PE=1 SV=2
7	G5EFX8	6.72e-61	219	701	0.171	0.184	G5EFX8_CAEEL Not3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ntl-3 PE=1 SV=1
8	P06102	2.29e-47	182	836	0.125	0.112	NOT3_YEAST General negative regulator of transcription subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NOT3 PE=1 SV=2
9	Q12514	6.36e-43	166	560	0.120	0.161	NOT5_YEAST General negative regulator of transcription subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NOT5 PE=1 SV=1
10	A0A1D8PE87	8.93e-43	167	662	0.127	0.145	A0A1D8PE87_CANAL General negative regulator of transcription subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=NOT5 PE=3 SV=1
11	F4JWJ7	7.40e-36	147	845	0.106	0.095	F4JWJ7_ARATH Transcription regulator NOT2/NOT3/NOT5 family protein OS=Arabidopsis thaliana OX=3702 GN=NOT3 PE=1 SV=1
12	Q57ZB9	8.81e-24	108	604	0.066	0.083	Q57ZB9_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.30P12.810 PE=3 SV=1
13	Q52JK6	5.96e-14	77.8	603	0.046	0.058	VIP2_NICBE Probable NOT transcription complex subunit VIP2 (Fragment) OS=Nicotiana benthamiana OX=4100 GN=VIP2 PE=1 SV=1
14	A8MR45	1.01e-13	77.0	614	0.048	0.059	A8MR45_ARATH NOT2 / NOT3 / NOT5 family OS=Arabidopsis thaliana OX=3702 GN=NOT2A PE=1 SV=1
15	Q9FPW4	5.48e-12	71.6	614	0.048	0.059	VIP2_ARATH Probable NOT transcription complex subunit VIP2 OS=Arabidopsis thaliana OX=3702 GN=VIP2 PE=1 SV=2
16	F8VV52	9.05e-11	67.4	531	0.044	0.062	F8VV52_HUMAN CCR4-NOT transcription complex subunit 2 (Fragment) OS=Homo sapiens OX=9606 GN=CNOT2 PE=1 SV=1
17	F8VUB4	9.74e-11	67.4	520	0.044	0.063	F8VUB4_HUMAN CCR4-NOT transcription complex subunit 2 OS=Homo sapiens OX=9606 GN=CNOT2 PE=1 SV=2
18	Q9NZN8	1.10e-10	67.4	540	0.044	0.061	CNOT2_HUMAN CCR4-NOT transcription complex subunit 2 OS=Homo sapiens OX=9606 GN=CNOT2 PE=1 SV=1
19	Q8C5L3	1.23e-10	67.0	540	0.044	0.061	CNOT2_MOUSE CCR4-NOT transcription complex subunit 2 OS=Mus musculus OX=10090 GN=Cnot2 PE=1 SV=2
20	P87240	4.11e-10	63.9	306	0.052	0.127	NOT2_SCHPO General negative regulator of transcription subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=not2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04153 NOT2_3_5	4.5e-37	138.5	NOT2 / NOT3 / NOT5 family
2	PF04065 Not3	2.1e-91	317.0	Not1 N-terminal domain, CCR4-Not complex component

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351159

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229195	0.999	CCR4-NOT transcription complex subunit 2
2	9606.ENSP00000273064	0.999	CCR4-NOT transcription complex subunit 9
3	9606.ENSP00000320949	0.999	CCR4-NOT transcription complex subunit 1
4	9606.ENSP00000355279	0.999	CCR4-NOT transcription complex subunit 7
5	9606.ENSP00000377024	0.999	CCR4-NOT transcription complex subunit 6
6	9606.ENSP00000445508	0.999	CCR4-NOT transcription complex subunit 4
7	9606.ENSP00000424896	0.998	CCR4-NOT transcription complex subunit 6-like
8	9606.ENSP00000430493	0.998	CCR4-NOT transcription complex subunit 8
9	9606.ENSP00000289382	0.993	CCR4-NOT transcription complex subunit 11
10	9606.ENSP00000399862	0.983	CCR4-NOT transcription complex subunit 10
11	9606.ENSP00000427695	0.974	Protein Tob1
12	9606.ENSP00000313007	0.960	Polyadenylate-binding protein 1
13	9606.ENSP00000437271	0.941	182 kDa tankyrase-1-binding protein
14	9606.ENSP00000302768	0.937	Polyadenylate-binding protein-interacting protein 1
15	9606.ENSP00000416255	0.932	Eukaryotic translation initiation factor 4 gamma 1
16	9606.ENSP00000293831	0.930	Eukaryotic initiation factor 4A-I
17	9606.ENSP00000388806	0.915	Eukaryotic translation initiation factor 4B
18	9606.ENSP00000326381	0.913	Eukaryotic initiation factor 4A-II
19	9606.ENSP00000425561	0.912	Eukaryotic translation initiation factor 4E
20	9606.ENSP00000482128	0.910	Cytoplasmic polyadenylation element-binding protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0051239	0.952	regulation of multicellular organismal process
GO:0050793	0.949	regulation of developmental process
GO:0009987	0.832	cellular process
GO:0019222	0.675	regulation of metabolic process
GO:0048518	0.534	positive regulation of biological process
GO:0050794	0.526	regulation of cellular process
GO:0060255	0.495	regulation of macromolecule metabolic process
GO:0010468	0.494	regulation of gene expression
GO:0051171	0.453	regulation of nitrogen compound metabolic process
GO:0080090	0.452	regulation of primary metabolic process
GO:0031323	0.452	regulation of cellular metabolic process
GO:0010556	0.426	regulation of macromolecule biosynthetic process
GO:0031326	0.426	regulation of cellular biosynthetic process
GO:0051252	0.424	regulation of RNA metabolic process
GO:0071704	0.395	organic substance metabolic process
GO:0009893	0.360	positive regulation of metabolic process
GO:0044237	0.348	cellular metabolic process
GO:0043170	0.335	macromolecule metabolic process
GO:2000036	0.322	regulation of stem cell population maintenance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0032991	0.999	protein-containing complex
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0140535	0.984	intracellular protein-containing complex
GO:0031981	0.963	nuclear lumen
GO:0005654	0.949	nucleoplasm
GO:0030014	0.920	CCR4-NOT complex
GO:0099080	0.572	supramolecular complex
GO:0035770	0.544	ribonucleoprotein granule
GO:0036464	0.526	cytoplasmic ribonucleoprotein granule
GO:0000932	0.496	P-body
GO:0016020	0.344	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]