StarFunc result for job id O75177

User Input

>input (396 residues)
MSVAFASARPRGKGEVTQQTIQKMLDENHHLIQCILEYQSKGKTAECTQYQQILHRNLVY
LATIADSNQNMQSLLPAPPTQNMNLGPGALTQSGSSQGLHSQGSLSDAISTGLPPSSLLQ
GQIGNGPSHVSMQQTAPNTLPTTSMSISGPGYSHAGPASQGVPMQGQGTIGNYVSRTNIN
MQSNPVSMMQQQAATSHYSSAQGGSQHYQGQSSIAMMGQGSQGSSMMGQRPMAPYRPSQQ
GSSQQYLGQEEYYGEQYSHSQGAAEPMGQQYYPDGHGDYAYQQSSYTEQSYDRSFEESTQ
HYYEGGNSQYSQQQAGYQQGAAQQQTYSQQQYPSQQSYPGQQQGYGSAQGAPSQYPGYQQ
GQGQQYGSYRAPQTAPSAQQQRPYGYEQGQYGNYQQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BW22	0.374	0.370	4.374E-47	402	0.912	0.898	Q8BW22.pdb.gz	CREST_MOUSE Calcium-responsive transactivator OS=Mus musculus OX=10090 GN=Ss18l1 PE=1 SV=1
2	AFDB:A4PIV7	0.190	0.158	2.279E-29	488	0.614	0.498	A4PIV7.pdb.gz	A4PIV7_HUMAN Fusion protein SYT-SSX1 OS=Homo sapiens OX=9606 GN=SYT-SSX1 PE=1 SV=1
3	AFDB:Q920B0	0.095	0.045	4.972E-2	1035	0.169	0.065	Q920B0.pdb.gz	FRM4B_MOUSE FERM domain-containing protein 4B OS=Mus musculus OX=10090 GN=Frmd4b PE=1 SV=2
4	AFDB:Q9CXH7	0.078	0.063	5.334E-2	517	0.149	0.114	Q9CXH7.pdb.gz	SGO1_MOUSE Shugoshin 1 OS=Mus musculus OX=10090 GN=Sgo1 PE=2 SV=1
5	AFDB:A0A5F9ZH11	0.089	0.036	8.727E-2	1253	0.146	0.046	A0A5F9ZH11.pdb.gz	A0A5F9ZH11_HUMAN Bromodomain and PHD finger containing 1 OS=Homo sapiens OX=9606 GN=BRPF1 PE=1 SV=2
6	AFDB:O35464	0.070	0.031	8.727E-2	1031	0.162	0.062	O35464.pdb.gz	SEM6A_MOUSE Semaphorin-6A OS=Mus musculus OX=10090 GN=Sema6a PE=1 SV=2
7	AFDB:O94421	0.123	0.036	8.727E-2	1680	0.184	0.043	O94421.pdb.gz	SNF22_SCHPO SWI/SNF chromatin-remodeling complex subunit snf22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snf22 PE=1 SV=2
8	AFDB:Q8VYM7	0.090	0.091	8.727E-2	388	0.164	0.168	Q8VYM7.pdb.gz	Q8VYM7_ARATH Hydroxyproline-rich glycoprotein family protein OS=Arabidopsis thaliana OX=3702 GN=ESP1 PE=1 SV=1
9	AFDB:Q9P2Q2	0.102	0.057	1.078E-1	1039	0.184	0.070	Q9P2Q2.pdb.gz	FRM4A_HUMAN FERM domain-containing protein 4A OS=Homo sapiens OX=9606 GN=FRMD4A PE=1 SV=3
10	AFDB:Q9VUB7	0.141	0.028	1.156E-1	2294	0.260	0.045	Q9VUB7.pdb.gz	Q9VUB7_DROME PAX transcription activation domain interacting protein OS=Drosophila melanogaster OX=7227 GN=Ptip PE=1 SV=3
11	PDB:6r1mB	0.126	0.118	8.718E-1	428	0.023	0.021	6r1mB.pdb.gz	Structure-Guided Enhancement of Selectivity of Chemical Probe Inhibitors Targeting Bacterial Seryl-tRNA Synthetase.
12	PDB:5n9jV	0.119	0.346	1.003	99	0.023	0.091	5n9jV.pdb.gz
13	PDB:4e6kA	0.140	0.337	1.329	157	0.028	0.070	4e6kA.pdb.gz	The Structure of the BfrB-Bfd Complex Reveals Protein-Protein Interactions Enabling Iron Release from Bacterioferritin.
14	PDB:3frtB	0.096	0.206	1.530	142	0.020	0.056	3frtB.pdb.gz
15	PDB:2wtlA	0.140	0.327	1.642	161	0.023	0.056	2wtlA.pdb.gz	Crystal Structure of Bfra from Mycobacterium Tuberculosis:Incorporation of Selenomethionine Results in Cleavage and Demetallation of Haem
16	PDB:4gwpC	0.126	0.252	1.761	184	0.033	0.071	4gwpC.pdb.gz
17	PDB:7o6eA	0.133	0.280	1.761	177	0.020	0.045	7o6eA.pdb.gz
18	PDB:1b71A	0.130	0.250	1.890	191	0.025	0.052	1b71A.pdb.gz	Alternative metal-binding sites in rubrerythrin.
19	PDB:7vrcC	0.107	0.306	1.890	109	0.043	0.156	7vrcC.pdb.gz
20	PDB:1tjlA	0.127	0.330	2.027	145	0.020	0.055	1tjlA.pdb.gz	Regulation through the secondary channel--structural framework for ppGpp-DksA synergism during transcription

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75177	0.0	760	396	1.000	1.000	CREST_HUMAN Calcium-responsive transactivator OS=Homo sapiens OX=9606 GN=SS18L1 PE=1 SV=2
2	Q8BW22	0.0	613	402	0.912	0.898	CREST_MOUSE Calcium-responsive transactivator OS=Mus musculus OX=10090 GN=Ss18l1 PE=1 SV=1
3	Q91XJ0	0.0	588	401	0.859	0.848	CREST_RAT Calcium-responsive transcription coactivator OS=Rattus norvegicus OX=10116 GN=Ss18l1 PE=1 SV=1
4	Q62280	4.45e-110	331	418	0.621	0.589	SSXT_MOUSE Protein SSXT OS=Mus musculus OX=10090 GN=Ss18 PE=1 SV=2
5	Q15532	2.84e-99	303	418	0.606	0.574	SSXT_HUMAN Protein SSXT OS=Homo sapiens OX=9606 GN=SS18 PE=1 SV=3
6	Q4VAX2	1.45e-98	301	418	0.604	0.572	Q4VAX2_HUMAN Synovial sarcoma translocation, chromosome 18 OS=Homo sapiens OX=9606 GN=SS18 PE=1 SV=1
7	A4PIV7	2.47e-98	303	488	0.475	0.385	A4PIV7_HUMAN Fusion protein SYT-SSX1 OS=Homo sapiens OX=9606 GN=SYT-SSX1 PE=1 SV=1
8	A4PIW0	4.00e-77	247	457	0.409	0.354	A4PIW0_HUMAN Fusion protein SYT-SSX2 OS=Homo sapiens OX=9606 GN=SYT-SSX2 PE=1 SV=1
9	Q9BR54	2.11e-44	152	128	0.192	0.594	Q9BR54_HUMAN SS18L1 subunit of BAF chromatin remodeling complex (Fragment) OS=Homo sapiens OX=9606 GN=SS18L1 PE=4 SV=1
10	Q9UHA2	8.63e-26	101	77	0.109	0.558	S18L2_HUMAN SS18-like protein 2 OS=Homo sapiens OX=9606 GN=SS18L2 PE=1 SV=1
11	Q93VH6	2.35e-13	71.2	223	0.078	0.139	GIF3_ARATH GRF1-interacting factor 3 OS=Arabidopsis thaliana OX=3702 GN=GIF3 PE=1 SV=1
12	Q9MAL9	5.75e-13	69.3	195	0.076	0.154	GIF2_ARATH GRF1-interacting factor 2 OS=Arabidopsis thaliana OX=3702 GN=GIF2 PE=1 SV=1
13	F4HQJ3	5.45e-10	61.2	229	0.066	0.114	F4HQJ3_ARATH GRF1-interacting factor 2 OS=Arabidopsis thaliana OX=3702 GN=GIF2 PE=1 SV=1
14	A5HEH4	1.18e-09	60.5	227	0.071	0.123	GIF1_MAIZE GRF-interacting factor 1 OS=Zea mays OX=4577 GN=GIF1 PE=1 SV=1
15	Q6AVI1	3.22e-09	58.9	227	0.071	0.123	GIF1_ORYSJ GRF-interacting factor 1 OS=Oryza sativa subsp. japonica OX=39947 GN=GIF1 PE=1 SV=1
16	Q8L8A5	8.60e-09	57.4	210	0.081	0.152	GIF1_ARATH GRF1-interacting factor 1 OS=Arabidopsis thaliana OX=3702 GN=GIF1 PE=1 SV=1
17	Q00539	6.2	31.6	523	0.051	0.038	NAM8_YEAST Protein NAM8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NAM8 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07011 Elf4	8.4e+02	11.3	Early Flowering 4 domain
2	PF05030 SSXT	6.9e-29	110.6	SSXT protein (N-terminal region)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000333012

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000436901	0.972	Zinc finger protein ubi-d4
2	9606.ENSP00000479526	0.961	Zinc finger protein DPF3
3	9606.ENSP00000323967	0.958	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1
4	9606.ENSP00000378414	0.946	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1
5	9606.ENSP00000263121	0.867	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
6	9606.ENSP00000267064	0.842	SWI/SNF complex subunit SMARCC2
7	9606.ENSP00000395654	0.829	Transcription activator BRG1
8	9606.ENSP00000347716	0.802	D4 zinc and double PHD fingers family 1 variant 4
9	9606.ENSP00000369674	0.799	B-cell CLL/lymphoma 7 protein family member C
10	9606.ENSP00000322885	0.790	Probable E3 ubiquitin-protein ligase DTX2
11	9606.ENSP00000411073	0.790	B-cell CLL/lymphoma 7 protein family member B
12	9606.ENSP00000332208	0.788	DNA-binding protein RFX6
13	9606.ENSP00000374529	0.785	Cyclin-K
14	9606.ENSP00000160382	0.781	Actin-like protein 6B
15	9606.ENSP00000379946	0.779	BRD4-interacting chromatin-remodeling complex-associated protein
16	9606.ENSP00000257600	0.760	E3 ubiquitin-protein ligase DTX1
17	9606.ENSP00000469011	0.722	Synovial sarcoma, X breakpoint 4
18	9606.ENSP00000469394	0.722	Protein SSX4
19	9606.ENSP00000445868	0.716	B-cell CLL/lymphoma 7 protein family member A
20	9606.ENSP00000254480	0.696	SWI/SNF complex subunit SMARCC1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0009987	0.979	cellular process
GO:0048518	0.979	positive regulation of biological process
GO:0048522	0.955	positive regulation of cellular process
GO:0050773	0.950	regulation of dendrite development
GO:0019222	0.936	regulation of metabolic process
GO:0010468	0.925	regulation of gene expression
GO:0080090	0.914	regulation of primary metabolic process
GO:0051171	0.910	regulation of nitrogen compound metabolic process
GO:0031323	0.910	regulation of cellular metabolic process
GO:0016043	0.895	cellular component organization
GO:0019219	0.892	regulation of nucleobase-containing compound metabolic process
GO:0009893	0.851	positive regulation of metabolic process
GO:0051252	0.846	regulation of RNA metabolic process
GO:0010556	0.830	regulation of macromolecule biosynthetic process
GO:0031326	0.826	regulation of cellular biosynthetic process
GO:0006355	0.816	regulation of DNA-templated transcription
GO:0010604	0.805	positive regulation of macromolecule metabolic process
GO:0045935	0.649	positive regulation of nucleobase-containing compound metabolic process
GO:0009891	0.628	positive regulation of biosynthetic process
GO:0051254	0.627	positive regulation of RNA metabolic process
GO:0031328	0.616	positive regulation of cellular biosynthetic process
GO:0045893	0.610	positive regulation of DNA-templated transcription
GO:0032502	0.531	developmental process
GO:0032501	0.473	multicellular organismal process
GO:0048856	0.467	anatomical structure development
GO:0051239	0.414	regulation of multicellular organismal process
GO:0051094	0.397	positive regulation of developmental process
GO:0007275	0.387	multicellular organism development
GO:0022603	0.374	regulation of anatomical structure morphogenesis
GO:0031346	0.306	positive regulation of cell projection organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005694	0.998	chromosome
GO:0032991	0.990	protein-containing complex
GO:0005829	0.980	cytosol
GO:0000785	0.960	chromatin
GO:1902494	0.942	catalytic complex
GO:0140513	0.937	nuclear protein-containing complex
GO:1904949	0.920	ATPase complex
GO:0070603	0.893	SWI/SNF superfamily-type complex
GO:0000793	0.890	condensed chromosome
GO:0000775	0.887	chromosome, centromeric region
GO:0000779	0.867	condensed chromosome, centromeric region
GO:0071565	0.387	nBAF complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]