StarFunc result for job id O75179

User Input

>input (2603 residues)
MEKATVPVAAATAAEGEGSPPAVAAVAGPPAAAEVGGGVGGSSRARSASSPRGMVRVCDL
LLKKKPPQQQHHKAKRNRTCRPPSSSESSSDSDNSGGGGGGGGGGGGGGGTSSNNSEEEE
DDDDEEEEVSEVESFILDQDDLENPMLETASKLLLSGTADGADLRTVDPETQARLEALLE
AAGIGKLSTADGKAFADPEVLRRLTSSVSCALDEAAAALTRMRAESTANAGQSDNRSLAE
ACSEGDVNAVRKLLIEGRSVNEHTEEGESLLCLACSAGYYELAQVLLAMHANVEDRGIKG
DITPLMAAANGGHVKIVKLLLAHKADVNAQSSTGNTALTYACAGGYVDVVKVLLESGASI
EDHNENGHTPLMEAGSAGHVEVARLLLENGAGINTHSNEFKESALTLACYKGHLEMVRFL
LEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDSGAQVNMPADSFESPLTLAACGGHV
ELAALLIERGASLEEVNDEGYTPLMEAAREGHEEMVALLLGQGANINAQTEETQETALTL
ACCGGFLEVADFLIKAGADIELGCSTPLMEAAQEGHLELVKYLLAAGANVHATTATGDTA
LTYACENGHTDVADVLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGANVNRTT
ANNDHTVLSLACAGGHLAVVELLLAHGADPTHRLKDGSTMLIEAAKGGHTSVVCYLLDYP
NNLLSAPPPDVTQLTPPSHDLNRAPRVPVQALPMVVPPQEPDKPPANVATTLPIRNKAAS
KQKSSSHLPANSQDVQGYITNQSPESIVEEAQGKLTELEQRIKEAIEKNAQLQSLELAHA
DQLTKEKIEELNKTREEQIQKKQKILEELQKVERELQLKTQQQLKKQYLEVKAQRIQLQQ
QQQQSCQHLGLLTPVGVGEQLSEGDYARLQQVDPVLLKDEPQQTAAQMGFAPIQPLAMPQ
ALPLAAGPLPPGSIANLTELQGVIVGQPVLGQAQLAGLGQGILTETQQGLMVASPAQTLN
DTLDDIMAAVSGRASAMSNTPTHSIAASISQPQTPTPSPIISPSAMLPIYPAIDIDAQTE
SNHDTALTLACAGGHEELVQTLLERGASIEHRDKKGFTPLILAATAGHVGVVEILLDNGA
DIEAQSERTKDTPLSLACSGGRQEVVELLLARGANKEHRNVSDYTPLSLAASGGYVNIIK
ILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLAC
FQGRTEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYAEVGRVLLDKGADVNAPPVPSSR
DTALTIAADKGHYKFCELLIGRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVQAGADVD
AADNRKITPLMAAFRKGHVKVVRYLVKEVNQFPSDSECMRYIATITDKEMLKKCHLCMES
IVQAKDRQAAEANKNASILLEELDLEKLREESRRLALAAKREKRKEKRRKKKEEQRRKLE
EIEAKNKENFELQAAQEKEKLKVEDEPEVLTEPPSATTTTTIGISATWTTLAGSHGKRNN
TITTTSSKRKNRKNKITPENVQIIFDDPLPISYSQPEKVNGESKSSSTSESGDSDNMRIS
SCSDESSNSNSSRKSDNHSPAVVTTTVSSKKQPSVLVTFPKEERKSVSGKASIKLSETIS
EGTSNSLSTCTKSGPSPLSSPNGKLTVASPKRGQKREEGWKEVVRRSKKVSVPSTVISRV
IGRGGCNINAIREFTGAHIDIDKQKDKTGDRIITIRGGTESTRQATQLINALIKDPDKEI
DELIPKNRLKSSSANSKIGSSAPTTTAANTSLMGIKMTTVALSSTSQTATALTVPAISSA
STHKTIKNPVNNVRPGFPVSLPLAYPPPQFAHALLAAQTFQQIRPPRLPMTHFGGTFPPA
QSTWGPFPVRPLSPARATNSPKPHMVPRHSNQNSSGSQVNSAGSLTSSPTTTTSSSASTV
PGTSTNGSPSSPSVRRQLFVTVVKTSNATTTTVTTTASNNNTAPTNATYPMPTAKEHYPV
SSPSSPSPPAQPGGVSRNSPLDCGSASPNKVASSSEQEAGSPPVVETTNTRPPNSSSSSG
SSSAHSNQQQPPGSVSQEPRPPLQQSQVPPPEVRMTVPPLATSSAPVAVPSTAPVTYPMP
QTPMGCPQPTPKMETPAIRPPPHGTTAPHKNSASVQNSSVAVLSVNHIKRPHSVPSSVQL
PSTLSTQSACQNSVHPANKPIAPNFSAPLPFGPFSTLFENSPTSAHAFWGGSVVSSQSTP
ESMLSGKSSYLPNSDPLHQSDTSKAPGFRPPLQRPAPSPSGIVNMDSPYGSVTPSSTHLG
NFASNISGGQMYGPGAPLGGAPAAANFNRQHFSPLSLLTPCSSASNDSSAQSVSSGVRAP
SPAPSSVPLGSEKPSNVSQDRKVPVPIGTERSARIRQTGTSAPSVIGSNLSTSVGHSGIW
SFEGIGGNQDKVDWCNPGMGNPMIHRPMSDPGVFSQHQAMERDSTGIVTPSGTFHQHVPA
GYMDFPKVGGMPFSVYGNAMIPPVAPIPDGAGGPIFNGPHAADPSWNSLIKMVSSSTENN
GPQTVWTGPWAPHMNSVHMNQLG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K916	0.370	0.369	0.000	2615	0.598	0.595	A0A0G2K916.pdb.gz	A0A0G2K916_RAT Eukaryotic translation initiation factor 4E binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ankhd1 PE=1 SV=1
2	AFDB:E9QEX9	0.363	0.362	0.000	2607	0.617	0.616	E9QEX9.pdb.gz	E9QEX9_DANRE Ankyrin repeat and KH domain-containing 1 OS=Danio rerio OX=7955 GN=ankhd1 PE=1 SV=1
3	AFDB:O75179	0.999	0.999	0.000	2603	1.000	1.000	O75179.pdb.gz	ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3
4	AFDB:Q8N8A2	0.236	0.565	3.309E-43	993	0.101	0.266	Q8N8A2.pdb.gz	ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens OX=9606 GN=ANKRD44 PE=1 SV=3
5	AFDB:G5E8K5	0.175	0.226	5.432E-42	1961	0.154	0.204	G5E8K5.pdb.gz	ANK3_MOUSE Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1
6	AFDB:O15084	0.298	0.698	5.645E-42	1053	0.097	0.239	O15084.pdb.gz	ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28 PE=1 SV=5
7	PDB:8cs9A	0.163	0.451	7.971E-40	796	0.103	0.337	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
8	AFDB:Q0KIE7	0.188	0.306	1.842E-39	1549	0.098	0.164	Q0KIE7.pdb.gz	Q0KIE7_DROME Ankyrin, isoform B OS=Drosophila melanogaster OX=7227 GN=Ank PE=1 SV=1
9	AFDB:D3Z9Z0	0.175	0.260	9.071E-33	1707	0.094	0.144	D3Z9Z0.pdb.gz	D3Z9Z0_RAT Ankyrin 1 OS=Rattus norvegicus OX=10116 GN=Ank1 PE=1 SV=2
10	PDB:5vkqA	0.194	0.317	2.865E-30	1499	0.100	0.174	5vkqA.pdb.gz
11	AFDB:Q54KA7	0.176	0.451	5.606E-25	986	0.057	0.151	Q54KA7.pdb.gz	SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum OX=44689 GN=secG PE=2 SV=1
12	AFDB:Q96Q27	0.131	0.529	2.368E-18	587	0.045	0.199	Q96Q27.pdb.gz	ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens OX=9606 GN=ASB2 PE=1 SV=2
13	PDB:4oauC	0.096	0.306	1.318E-12	692	0.040	0.152	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
14	PDB:2dvwA	0.083	0.857	2.072E-9	229	0.024	0.275	2dvwA.pdb.gz
15	PDB:6v9hC	0.071	0.511	2.231E-8	270	0.032	0.311	6v9hC.pdb.gz
16	PDB:1wg0A	0.083	0.827	7.606E-8	243	0.022	0.235	1wg0A.pdb.gz
17	PDB:6aunA	0.096	0.372	7.606E-8	618	0.031	0.131	6aunA.pdb.gz
18	PDB:6pqpA	0.073	0.272	7.300E-7	615	0.024	0.102	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
19	PDB:6mwqA	0.062	0.298	1.763E-6	493	0.035	0.183	6mwqA.pdb.gz
20	PDB:6dmwA	0.092	0.305	2.219E-6	631	0.030	0.125	6dmwA.pdb.gz	Structural insights on TRPV5 gating by endogenous modulators.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K916	0.0	2747	2615	0.597	0.594	A0A0G2K916_RAT Eukaryotic translation initiation factor 4E binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ankhd1 PE=1 SV=1
2	A0A0R4IUB2	0.0	2779	2580	0.610	0.616	A0A0R4IUB2_DANRE Ankyrin repeat and KH domain-containing 1 OS=Danio rerio OX=7955 GN=ankhd1 PE=1 SV=2
3	E9QEX9	0.0	2768	2607	0.610	0.610	E9QEX9_DANRE Ankyrin repeat and KH domain-containing 1 OS=Danio rerio OX=7955 GN=ankhd1 PE=1 SV=1
4	H0YM23	0.0	5085	2487	0.955	1.000	H0YM23_HUMAN Ankyrin repeat domain 17 (Fragment) OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=1
5	O75179	0.0	5321	2603	1.000	1.000	ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3
6	Q8IWZ3	0.0	2777	2542	0.594	0.608	ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKHD1 PE=1 SV=1
7	Q99NH0	0.0	5115	2603	0.966	0.966	ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus OX=10090 GN=Ankrd17 PE=1 SV=2
8	Q9VCA8	0.0	665	4001	0.122	0.079	ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster OX=7227 GN=mask PE=1 SV=2
9	A0A0A0MQZ8	7.17e-93	325	866	0.077	0.232	A0A0A0MQZ8_HUMAN Ankyrin repeat and KH domain containing 1 OS=Homo sapiens OX=9606 GN=ANKHD1 PE=1 SV=1
10	Q8IWG5	1.00e-91	322	866	0.077	0.231	Q8IWG5_HUMAN ANKHD1 protein OS=Homo sapiens OX=9606 GN=ANKHD1 PE=1 SV=1
11	Q9ULJ7	4.33e-65	248	1429	0.071	0.130	ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens OX=9606 GN=ANKRD50 PE=1 SV=4
12	A0A5F9ZI40	8.84e-65	248	3915	0.064	0.043	A0A5F9ZI40_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
13	A0A5F9ZHR8	9.09e-65	248	3939	0.064	0.042	A0A5F9ZHR8_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
14	A0A5F9ZHD2	9.48e-65	248	3936	0.064	0.042	A0A5F9ZHD2_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
15	A0A5F9ZH19	1.01e-64	248	3895	0.064	0.043	A0A5F9ZH19_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
16	A0A5F9ZHN5	1.02e-64	248	3903	0.064	0.043	A0A5F9ZHN5_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
17	I6L894	1.02e-64	248	3924	0.064	0.043	I6L894_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
18	A0A5F9ZGY3	1.03e-64	248	3934	0.064	0.042	A0A5F9ZGY3_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
19	Q01484	1.09e-64	248	3957	0.064	0.042	ANK2_HUMAN Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=4
20	A0A5F9ZGY4	1.16e-64	248	3848	0.064	0.043	A0A5F9ZGY4_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1e-112	375.6	Ankyrin repeat
2	PF12796 Ank_2	7.6e-146	486.4	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	5.2e-100	326.0	Ankyrin repeat
4	PF13637 Ank_4	2.6e-123	412.2	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.1e-91	310.9	Ankyrin repeats (many copies)
6	PF00013 KH_1	1.2e-11	55.6	KH domain
7	PF13083 KH_4	79	14.6	KH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351416

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000420270	0.709	Serine/threonine-protein kinase Kist
2	9606.ENSP00000444029	0.700	Nuclear pore complex protein Nup153
3	9606.ENSP00000340578	0.684	Ras association domain-containing protein 6
4	9606.ENSP00000479919	0.674	Endophilin-B1
5	9606.ENSP00000326170	0.663	E3 ubiquitin-protein ligase rififylin
6	9606.ENSP00000368540	0.613	Ubiquitin associated protein 2
7	9606.ENSP00000362774	0.607	Roquin-2
8	9606.ENSP00000343629	0.593	Protein PRRC2C
9	9606.ENSP00000155926	0.587	Tribbles homolog 2
10	9606.ENSP00000380718	0.584	Chromodomain Y-like protein
11	9606.ENSP00000278618	0.578	L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
12	9606.ENSP00000236979	0.577	Spermatid nuclear transition protein 1
13	9606.ENSP00000367623	0.570	Heat shock 70 kDa protein 14
14	9606.ENSP00000397261	0.564	Selenium-binding protein 1
15	9606.ENSP00000425261	0.557	Mitochondrial inner membrane protein COX18
16	9606.ENSP00000361160	0.552	Microtubule-binding protein which might play a role in microtubule bundling
17	9606.ENSP00000262519	0.529	Histone-lysine N-methyltransferase SETD1A
18	9606.ENSP00000442924	0.525	Histone-lysine N-methyltransferase SETD1B
19	9606.ENSP00000319992	0.521	Transmembrane protein 11, mitochondrial
20	9606.ENSP00000391723	0.520	Pumilio homolog 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	1.000	chromatin binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0009987	0.819	cellular process
GO:0019222	0.798	regulation of metabolic process
GO:0060255	0.770	regulation of macromolecule metabolic process
GO:0048519	0.719	negative regulation of biological process
GO:0051171	0.714	regulation of nitrogen compound metabolic process
GO:0080090	0.707	regulation of primary metabolic process
GO:0031323	0.689	regulation of cellular metabolic process
GO:0048518	0.635	positive regulation of biological process
GO:0048522	0.596	positive regulation of cellular process
GO:0019219	0.526	regulation of nucleobase-containing compound metabolic process
GO:0032501	0.503	multicellular organismal process
GO:0050896	0.499	response to stimulus
GO:0048523	0.475	negative regulation of cellular process
GO:0032502	0.393	developmental process
GO:0010468	0.349	regulation of gene expression
GO:0071704	0.338	organic substance metabolic process
GO:0048583	0.325	regulation of response to stimulus
GO:0048856	0.305	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0016020	0.997	membrane
GO:0043232	0.990	intracellular non-membrane-bounded organelle
GO:0005737	0.977	cytoplasm
GO:0031090	0.942	organelle membrane
GO:0012505	0.940	endomembrane system
GO:0005829	0.921	cytosol
GO:0031975	0.868	envelope
GO:0031967	0.852	organelle envelope
GO:0031965	0.815	nuclear membrane
GO:0005694	0.385	chromosome
GO:0032991	0.372	protein-containing complex
GO:0000785	0.369	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]