StarFunc result for job id O75182

User Input

>input (1162 residues)
MAHAGGGSGGSGAGGPAGRGLSGARWGRSGSAGHEKLPVHVEDALTYLDQVKIRFGSDPA
TYNGFLEIMKEFKSQSIDTPGVIRRVSQLFHEHPDLIVGFNAFLPLGYRIDIPKNGKLNI
QSPLTSQENSHNHGDGAEDFKQQVPYKEDKPQVPLESDSVEFNNAISYVNKIKTRFLDHP
EIYRSFLEILHTYQKEQLNTRGRPFRGMSEEEVFTEVANLFRGQEDLLSEFGQFLPEAKR
SLFTGNGPCEMHSVQKNEHDKTPEHSRKRSRPSLLRPVSAPAKKKMKLRGTKDLSIAAVG
KYGTLQEFSFFDKVRRVLKSQEVYENFLRCIALFNQELVSGSELLQLVSPFLGKFPELFA
QFKSFLGVKELSFAPPMSDRSGDGISREIDYASCKRIGSSYRALPKTYQQPKCSGRTAIC
KELDHWTLLQGSWTDDYCMSKFKNTCWIPGYSAGVLNDTWVSFPSWSEDSTFVSSKKTPY
EEQLHRCEDERFELDVVLETNLATIRVLESVQKKLSRMAPEDQEKFRLDDSLGGTSEVIQ
RRAIYRIYGDKAPEIIESLKKNPVTAVPVVLKRLKAKEEEWREAQQGFNKIWREQYEKAY
LKSLDHQAVNFKQNDTKALRSKSLLNEIESVYDEHQEQHSEGRSAPSSEPHLIFVYEDRQ
ILEDAAALISYYVKRQPAIQKEDQGTIHQLLHQFVPSLFFSQQLDLGASEESADEDRDSP
QGQTTDPSERKKPAPGPHSSPPEEKGAFGDAPATEQPPLPPPAPHKPLDDVYSLFFANNN
WYFFLRLHQTLCSRLLKIYRQAQKQLLEYRTEKEREKLLCEGRREKGSDPAMELRLKQPS
EVELEEYYPAFLDMVRSLLEGSIDPTQYEDTLREMFTIHAYVGFTMDKLVQNIARQLHHL
VSDDVCLKVVELYLNEKKRGAAGGNLSSRCVRAARETSYQWKAERCMADENCFKVMFLQR
KGQVIMTIELLDTEEAQTEDPVEVQHLARYVEQYVGTEGASSSPTEGFLLKPVFLQRNLK
KFRRRWQSEQARALRGEARSSWKRLVGVESACDVDCRFKLSTHKMVFIVNSEDYMYRRGT
LCRAKQVQPLVLLRHHQHFEEWHSRWLEDNVTVEAASLVQDWLMGEEDEDMVPCKTLCET
VHVHGLPVTRYRVQYSRRPASP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75182	1.000	1.000	0.000	1162	1.000	1.000	O75182.pdb.gz	SIN3B_HUMAN Paired amphipathic helix protein Sin3b OS=Homo sapiens OX=9606 GN=SIN3B PE=1 SV=2
2	AFDB:Q62141	0.442	0.466	0.000	1098	0.867	0.917	Q62141.pdb.gz	SIN3B_MOUSE Paired amphipathic helix protein Sin3b OS=Mus musculus OX=10090 GN=Sin3b PE=1 SV=2
3	AFDB:Q1LYM8	0.420	0.409	4.349E-104	1196	0.646	0.628	Q1LYM8.pdb.gz	Q1LYM8_DANRE Paired amphipathic helix protein Sin3b OS=Danio rerio OX=7955 GN=si:dkey-6n6.6 PE=1 SV=1
4	AFDB:A0A0G2K3H5	0.503	0.466	7.100E-90	1274	0.537	0.490	A0A0G2K3H5.pdb.gz	A0A0G2K3H5_RAT SIN3 transcription regulator family member A OS=Rattus norvegicus OX=10116 GN=Sin3a PE=1 SV=2
5	AFDB:A0A0B4K765	0.353	0.206	2.072E-65	2066	0.431	0.242	A0A0B4K765.pdb.gz	A0A0B4K765_DROME Sin3A, isoform G OS=Drosophila melanogaster OX=7227 GN=Sin3A PE=1 SV=1
6	AFDB:P22579	0.369	0.287	1.271E-49	1536	0.298	0.225	P22579.pdb.gz	SIN3_YEAST Transcriptional regulatory protein SIN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIN3 PE=1 SV=2
7	AFDB:A0A1D8PCC3	0.352	0.295	1.369E-48	1411	0.301	0.248	A0A1D8PCC3.pdb.gz	A0A1D8PCC3_CANAL Transcriptional regulator OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SIN3 PE=4 SV=1
8	AFDB:Q09750	0.334	0.259	7.737E-46	1522	0.267	0.204	Q09750.pdb.gz	PST1_SCHPO Paired amphipathic helix protein pst1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pst1 PE=1 SV=1
9	AFDB:Q9SRH9	0.374	0.326	3.840E-40	1372	0.274	0.232	Q9SRH9.pdb.gz	SNL1_ARATH Paired amphipathic helix protein Sin3-like 1 OS=Arabidopsis thaliana OX=3702 GN=SNL1 PE=1 SV=2
10	AFDB:Q9LFQ3	0.342	0.296	5.964E-40	1367	0.272	0.231	Q9LFQ3.pdb.gz	SNL2_ARATH Paired amphipathic helix protein Sin3-like 2 OS=Arabidopsis thaliana OX=3702 GN=SNL2 PE=1 SV=2
11	PDB:6p59A	0.036	0.160	1.968	157	0.008	0.057	6p59A.pdb.gz	Structural Basis for a Species-Specific Determinant of an SIV Vif Protein toward Hominid APOBEC3G Antagonism.
12	PDB:4igvA	0.026	0.132	2.346	149	0.007	0.054	4igvA.pdb.gz
13	PDB:1prqA	0.020	0.153	2.798	125	0.004	0.040	1prqA.pdb.gz
14	PDB:7lmaD	0.032	0.139	2.798	187	0.009	0.053	7lmaD.pdb.gz	Structures of telomerase at several steps of telomere repeat synthesis.
15	PDB:7fd4B	0.056	0.077	3.336	779	0.028	0.041	7fd4B.pdb.gz	Complete three-dimensional structures of the Lon protease translocating a protein substrate.
16	PDB:4iapA	0.035	0.094	3.487	256	0.015	0.070	4iapA.pdb.gz
17	PDB:5n47A	0.026	0.100	3.643	180	0.004	0.028	5n47A.pdb.gz
18	PDB:3bhdA	0.027	0.100	3.807	211	0.010	0.057	3bhdA.pdb.gz
19	PDB:3s26A	0.023	0.096	3.979	169	0.005	0.036	3s26A.pdb.gz
20	PDB:7q3eC	0.018	0.046	4.158	392	0.004	0.013	7q3eC.pdb.gz	Structure of the ciliogenesis-associated CPLANE complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K3H5	0.0	911	1257	0.435	0.402	A0A0G2K3H5_RAT SIN3 transcription regulator family member A OS=Rattus norvegicus OX=10116 GN=Sin3a PE=1 SV=2
2	D3ZBP2	0.0	1048	1277	0.473	0.431	D3ZBP2_RAT SIN3 transcription regulator family member A OS=Rattus norvegicus OX=10116 GN=Sin3a PE=1 SV=2
3	O75182	0.0	2416	1162	1.000	1.000	SIN3B_HUMAN Paired amphipathic helix protein Sin3b OS=Homo sapiens OX=9606 GN=SIN3B PE=1 SV=2
4	Q1LYM8	0.0	1449	1196	0.654	0.635	Q1LYM8_DANRE Paired amphipathic helix protein Sin3b OS=Danio rerio OX=7955 GN=si:dkey-6n6.6 PE=1 SV=1
5	Q60520	0.0	1052	1274	0.471	0.429	SIN3A_MOUSE Paired amphipathic helix protein Sin3a OS=Mus musculus OX=10090 GN=Sin3a PE=1 SV=3
6	Q62141	0.0	2030	1098	0.863	0.913	SIN3B_MOUSE Paired amphipathic helix protein Sin3b OS=Mus musculus OX=10090 GN=Sin3b PE=1 SV=2
7	Q96ST3	0.0	1038	1273	0.468	0.427	SIN3A_HUMAN Paired amphipathic helix protein Sin3a OS=Homo sapiens OX=9606 GN=SIN3A PE=1 SV=2
8	A0A0B4LF93	2.25e-127	431	1747	0.207	0.138	A0A0B4LF93_DROME Sin3A, isoform I OS=Drosophila melanogaster OX=7227 GN=Sin3A PE=1 SV=1
9	A1Z928	2.54e-127	431	1751	0.207	0.138	A1Z928_DROME Sin3A, isoform D OS=Drosophila melanogaster OX=7227 GN=Sin3A PE=1 SV=1
10	O17143	2.97e-127	431	1751	0.207	0.138	O17143_DROME Transcriptional co-repressor SIN3A OS=Drosophila melanogaster OX=7227 GN=Sin3A PE=2 SV=1
11	A0A126GUN9	3.53e-127	431	1786	0.207	0.135	A0A126GUN9_DROME Sin3A, isoform J OS=Drosophila melanogaster OX=7227 GN=Sin3A PE=1 SV=1
12	A1Z927	3.77e-127	431	1776	0.207	0.136	A1Z927_DROME Sin3A, isoform A OS=Drosophila melanogaster OX=7227 GN=Sin3A PE=1 SV=1
13	O17142	4.18e-127	430	1773	0.207	0.136	O17142_DROME Transcriptional co-repressor SIN3A OS=Drosophila melanogaster OX=7227 GN=Sin3A PE=2 SV=1
14	Q5U0Y0	2.13e-126	431	2062	0.207	0.117	Q5U0Y0_DROME LD13852p OS=Drosophila melanogaster OX=7227 GN=Sin3A PE=1 SV=1
15	A0A0B4LF82	1.50e-125	428	2060	0.207	0.117	A0A0B4LF82_DROME Sin3A, isoform H OS=Drosophila melanogaster OX=7227 GN=Sin3A PE=1 SV=1
16	A0A0B4K765	2.12e-125	427	2066	0.208	0.117	A0A0B4K765_DROME Sin3A, isoform G OS=Drosophila melanogaster OX=7227 GN=Sin3A PE=1 SV=1
17	O77025	3.05e-125	427	2061	0.206	0.116	O77025_DROME Transcription factor OS=Drosophila melanogaster OX=7227 GN=Sin3A PE=2 SV=1
18	O48686	8.00e-83	298	1330	0.206	0.180	SNL3_ARATH Paired amphipathic helix protein Sin3-like 3 OS=Arabidopsis thaliana OX=3702 GN=SNL3 PE=1 SV=3
19	Q9LFQ3	6.10e-82	296	1367	0.198	0.168	SNL2_ARATH Paired amphipathic helix protein Sin3-like 2 OS=Arabidopsis thaliana OX=3702 GN=SNL2 PE=1 SV=2
20	F4IEM8	9.20e-70	257	1167	0.182	0.182	F4IEM8_ARATH SIN3-like 5 OS=Arabidopsis thaliana OX=3702 GN=SNL5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16871 DUF5077	4.1e+02	12.3	Domain of unknown function (DUF5077)
2	PF02671 PAH	1.9e-37	138.5	Paired amphipathic helix repeat
3	PF16879 Sin3a_C	1.7e-78	275.9	C-terminal domain of Sin3a protein
4	PF08295 Sin3_corepress	3.2e-32	121.8	Sin3 family co-repressor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369131

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362649	0.999	Histone deacetylase 1
2	9606.ENSP00000430432	0.998	Histone deacetylase 2
3	9606.ENSP00000331310	0.997	Mortality factor 4-like protein 1
4	9606.ENSP00000296504	0.995	Histone deacetylase complex subunit SAP30
5	9606.ENSP00000369424	0.995	Histone-binding protein RBBP7
6	9606.ENSP00000329933	0.994	PHD finger protein 12
7	9606.ENSP00000443988	0.994	Sin3 histone deacetylase corepressor complex component SDS3
8	9606.ENSP00000362592	0.982	Histone-binding protein RBBP4
9	9606.ENSP00000481842	0.979	Histone deacetylase complex subunit SAP18
10	9606.ENSP00000268712	0.977	Nuclear receptor corepressor 1
11	9606.ENSP00000378402	0.972	Paired amphipathic helix protein Sin3a
12	9606.ENSP00000382688	0.972	Lysine-specific demethylase 5A
13	9606.ENSP00000264444	0.967	Max dimerization protein 1
14	9606.ENSP00000384018	0.963	Nuclear receptor corepressor 2
15	9606.ENSP00000368686	0.961	Transcription factor E2F4
16	9606.ENSP00000264183	0.959	AT-rich interactive domain-containing protein 4B
17	9606.ENSP00000395535	0.953	Methyl-CpG-binding protein 2
18	9606.ENSP00000362768	0.952	Retinoblastoma-like protein 1
19	9606.ENSP00000290921	0.946	C-terminal-binding protein 1
20	9606.ENSP00000225983	0.944	Histone deacetylase 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	0.956	chromatin binding
GO:0140110	0.695	transcription regulator activity
GO:0003676	0.429	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051172	0.990	negative regulation of nitrogen compound metabolic process
GO:0010558	0.989	negative regulation of macromolecule biosynthetic process
GO:0031327	0.989	negative regulation of cellular biosynthetic process
GO:0006355	0.988	regulation of DNA-templated transcription
GO:1903507	0.972	negative regulation of nucleic acid-templated transcription
GO:0045892	0.963	negative regulation of DNA-templated transcription
GO:0032502	0.920	developmental process
GO:0048856	0.907	anatomical structure development
GO:0032501	0.879	multicellular organismal process
GO:0007275	0.809	multicellular organism development
GO:0048513	0.724	animal organ development
GO:0009987	0.702	cellular process
GO:0006357	0.570	regulation of transcription by RNA polymerase II
GO:0048731	0.545	system development
GO:0051726	0.476	regulation of cell cycle
GO:0048518	0.426	positive regulation of biological process
GO:0048522	0.424	positive regulation of cellular process
GO:0050896	0.385	response to stimulus
GO:0009888	0.375	tissue development
GO:0060537	0.362	muscle tissue development
GO:0071704	0.324	organic substance metabolic process
GO:0061061	0.318	muscle structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0005737	0.991	cytoplasm
GO:0032991	0.970	protein-containing complex
GO:0005694	0.922	chromosome
GO:0000785	0.393	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]