StarFunc result for job id O75190

User Input

>input (326 residues)
MVDYYEVLGVQRHASPEDIKKAYRKLALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAK
KRDIYDKYGKEGLNGGGGGGSHFDSPFEFGFTFRNPDDVFREFFGGRDPFSFDFFEDPFE
DFFGNRRGPRGSRSRGTGSFFSAFSGFPSFGSGFSSFDTGFTSFGSLGHGGLTSFSSTSF
GGSGMGNFKSISTSTKMVNGRKITTKRIVENGQERVEVEEDGQLKSLTINGVADDDALAE
ERMRRGQNALPAQPAGLRPPKPPRPASLLRHAPHCLSEEEGEQDRPRAPGPWDPLASAAG
LKEGGKRKKQKQREESKKKKSTKGNH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0J9YX62	0.627	0.614	8.324E-49	334	0.936	0.913	A0A0J9YX62.pdb.gz	A0A0J9YX62_HUMAN DnaJ heat shock protein family (Hsp40) member B6 OS=Homo sapiens OX=9606 GN=DNAJB6 PE=1 SV=1
2	AFDB:O54946	0.656	0.589	2.387E-43	365	0.850	0.759	O54946.pdb.gz	DNJB6_MOUSE DnaJ homolog subfamily B member 6 OS=Mus musculus OX=10090 GN=Dnajb6 PE=1 SV=4
3	AFDB:Q6DHR2	0.553	0.569	5.540E-30	316	0.571	0.589	Q6DHR2.pdb.gz	Q6DHR2_DANRE DnaJ heat shock protein family (Hsp40) member B6a OS=Danio rerio OX=7955 GN=zgc:92148 PE=1 SV=1
4	AFDB:A0A1D5NSC8	0.475	0.496	4.886E-28	311	0.537	0.563	A0A1D5NSC8.pdb.gz
5	AFDB:O35723	0.530	0.695	1.239E-27	242	0.497	0.669	O35723.pdb.gz	DNJB3_MOUSE DnaJ homolog subfamily B member 3 OS=Mus musculus OX=10090 GN=Dnajb3 PE=2 SV=1
6	AFDB:Q7Z6W7	0.509	0.533	2.640E-27	309	0.549	0.579	Q7Z6W7.pdb.gz	DNJB7_HUMAN DnaJ homolog subfamily B member 7 OS=Homo sapiens OX=9606 GN=DNAJB7 PE=2 SV=2
7	AFDB:Q8NHS0	0.304	0.418	6.110E-26	232	0.439	0.616	Q8NHS0.pdb.gz	DNJB8_HUMAN DnaJ homolog subfamily B member 8 OS=Homo sapiens OX=9606 GN=DNAJB8 PE=1 SV=1
8	AFDB:P25686	0.463	0.466	6.864E-26	324	0.457	0.460	P25686.pdb.gz	DNJB2_HUMAN DnaJ homolog subfamily B member 2 OS=Homo sapiens OX=9606 GN=DNAJB2 PE=1 SV=3
9	AFDB:E9PH18	0.320	0.485	6.417E-24	211	0.647	1.000	E9PH18.pdb.gz	E9PH18_HUMAN DnaJ heat shock protein family (Hsp40) member B6 OS=Homo sapiens OX=9606 GN=DNAJB6 PE=1 SV=1
10	AFDB:Q9TY07	0.297	0.381	9.210E-14	249	0.270	0.353	Q9TY07.pdb.gz	Q9TY07_CAEEL J domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnj-24 PE=4 SV=3
11	PDB:6byrA	0.202	0.163	1.725E-3	405	0.129	0.104	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
12	PDB:7x3kA	0.201	0.247	1.047E-2	262	0.098	0.122	7x3kA.pdb.gz
13	PDB:5y88T	0.163	0.440	3.163E-2	107	0.074	0.224	5y88T.pdb.gz	Structure of an Intron Lariat Spliceosome from Saccharomyces cerevisiae
14	PDB:1fpoA	0.179	0.328	1.278E-1	171	0.043	0.082	1fpoA.pdb.gz
15	PDB:2l3aA	0.098	0.236	6.514E-1	82	0.028	0.110	2l3aA.pdb.gz
16	PDB:4fhmA	0.103	0.096	7.318E-1	354	0.018	0.017	4fhmA.pdb.gz
17	PDB:4wspA	0.111	0.388	1.038	79	0.040	0.165	4wspA.pdb.gz
18	PDB:3ul5D	0.049	0.135	1.100	84	0.028	0.107	3ul5D.pdb.gz
19	PDB:4ftxA	0.103	0.201	1.100	158	0.025	0.051	4ftxA.pdb.gz
20	PDB:3tgoD	0.074	0.117	1.235	186	0.028	0.048	3tgoD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75190	0.0	657	326	1.000	1.000	DNJB6_HUMAN DnaJ homolog subfamily B member 6 OS=Homo sapiens OX=9606 GN=DNAJB6 PE=1 SV=2
2	A0A0J9YX62	1.93e-180	503	334	0.936	0.913	A0A0J9YX62_HUMAN DnaJ heat shock protein family (Hsp40) member B6 OS=Homo sapiens OX=9606 GN=DNAJB6 PE=1 SV=1
3	C9J2C4	3.48e-163	456	228	0.699	1.000	C9J2C4_HUMAN DnaJ heat shock protein family (Hsp40) member B6 (Fragment) OS=Homo sapiens OX=9606 GN=DNAJB6 PE=1 SV=1
4	O54946	1.59e-146	419	365	0.853	0.762	DNJB6_MOUSE DnaJ homolog subfamily B member 6 OS=Mus musculus OX=10090 GN=Dnajb6 PE=1 SV=4
5	Q7Z6W7	1.86e-104	310	309	0.485	0.511	DNJB7_HUMAN DnaJ homolog subfamily B member 7 OS=Homo sapiens OX=9606 GN=DNAJB7 PE=2 SV=2
6	O35723	7.92e-95	283	242	0.494	0.665	DNJB3_MOUSE DnaJ homolog subfamily B member 3 OS=Mus musculus OX=10090 GN=Dnajb3 PE=2 SV=1
7	Q7ZW83	6.42e-89	268	237	0.460	0.633	Q7ZW83_DANRE DnaJ (Hsp40) homolog, subfamily B, member 6 OS=Danio rerio OX=7955 GN=dnajb6 PE=2 SV=1
8	Q8NHS0	7.09e-82	249	232	0.423	0.595	DNJB8_HUMAN DnaJ homolog subfamily B member 8 OS=Homo sapiens OX=9606 GN=DNAJB8 PE=1 SV=1
9	Q6DHR2	3.65e-75	235	316	0.515	0.532	Q6DHR2_DANRE DnaJ heat shock protein family (Hsp40) member B6a OS=Danio rerio OX=7955 GN=zgc:92148 PE=1 SV=1
10	P25686	6.87e-73	230	324	0.472	0.475	DNJB2_HUMAN DnaJ homolog subfamily B member 2 OS=Homo sapiens OX=9606 GN=DNAJB2 PE=1 SV=3
11	C9JRD2	7.49e-73	226	228	0.423	0.605	C9JRD2_HUMAN DnaJ heat shock protein family (Hsp40) member B2 (Fragment) OS=Homo sapiens OX=9606 GN=DNAJB2 PE=1 SV=1
12	E9PH18	5.93e-68	213	211	0.365	0.564	E9PH18_HUMAN DnaJ heat shock protein family (Hsp40) member B6 OS=Homo sapiens OX=9606 GN=DNAJB6 PE=1 SV=1
13	Q9TY07	1.74e-35	130	249	0.291	0.382	Q9TY07_CAEEL J domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnj-24 PE=4 SV=3
14	Q7KQK3	1.13e-34	128	244	0.288	0.385	Q7KQK3_PLAF7 Heat shock protein DNAJ homologue Pfj4 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1211400 PE=4 SV=1
15	Q80ZP0	4.16e-34	127	234	0.279	0.389	Q80ZP0_MOUSE 4930503B20Rik protein OS=Mus musculus OX=10090 GN=4930503B20Rik PE=2 SV=1
16	G5E8V6	8.41e-34	125	231	0.279	0.394	G5E8V6_MOUSE RIKEN cDNA 4930503B20 gene OS=Mus musculus OX=10090 GN=4930503B20Rik PE=4 SV=1
17	O76224	8.29e-31	120	336	0.199	0.193	O76224_9TRYP Chaperone OS=Trypanosoma brucei OX=5691 GN=DNAJ PE=4 SV=1
18	Q38AB7	8.29e-31	120	336	0.199	0.193	Q38AB7_TRYB2 Chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2000 PE=4 SV=1
19	O96123	8.29e-30	119	421	0.221	0.171	O96123_PLAF7 Knob associated heat shock protein 40 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0201800 PE=4 SV=3
20	Q6DEJ4	2.03e-29	117	335	0.193	0.188	Q6DEJ4_DANRE DnaJ (Hsp40) homolog, subfamily B, member 1 OS=Danio rerio OX=7955 GN=dnajb1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00226 DnaJ	2.4e-25	99.8	DnaJ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262177

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302961	0.999	Heat shock protein family A member 4
2	9606.ENSP00000432083	0.996	Heat shock cognate 71 kDa protein
3	9606.ENSP00000364802	0.984	Heat shock 70 kDa protein 1A
4	9606.ENSP00000310219	0.983	Heat shock 70 kDa protein 6
5	9606.ENSP00000367623	0.981	Heat shock 70 kDa protein 14
6	9606.ENSP00000297185	0.967	Stress-70 protein, mitochondrial
7	9606.ENSP00000364801	0.967	Heat shock protein family A member 1B
8	9606.ENSP00000378199	0.966	Heat shock-related 70 kDa protein 2
9	9606.ENSP00000324173	0.964	78 kDa glucose-regulated protein
10	9606.ENSP00000364805	0.960	Heat shock 70 kDa protein 1-like
11	9606.ENSP00000296464	0.956	Heat shock 70 kDa protein 4L
12	9606.ENSP00000285667	0.953	Heat shock 70 kDa protein 13
13	9606.ENSP00000254963	0.936	Heat shock protein family A member 12B
14	9606.ENSP00000358081	0.932	BAG family molecular chaperone regulator 3
15	9606.ENSP00000358211	0.931	Heat shock protein family A member 12A
16	9606.ENSP00000278483	0.912	Protein Hikeshi
17	9606.ENSP00000368752	0.900	Major prion protein
18	9606.ENSP00000376568	0.863	Myeloid leukemia factor 1
19	9606.ENSP00000264954	0.819	GrpE protein homolog 1, mitochondrial
20	9606.ENSP00000216489	0.783	Nucleic acid dioxygenase ALKBH1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051087	1.000	chaperone binding
GO:0051082	1.000	unfolded protein binding
GO:0031072	1.000	heat shock protein binding
GO:0001671	0.995	ATPase activator activity
GO:1901363	0.773	heterocyclic compound binding
GO:0097159	0.772	organic cyclic compound binding
GO:0003676	0.556	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0048519	0.983	negative regulation of biological process
GO:0019222	0.942	regulation of metabolic process
GO:0048523	0.933	negative regulation of cellular process
GO:0051248	0.919	negative regulation of protein metabolic process
GO:0006457	0.916	protein folding
GO:0016043	0.876	cellular component organization
GO:0045861	0.876	negative regulation of proteolysis
GO:0080134	0.829	regulation of response to stress
GO:0051128	0.820	regulation of cellular component organization
GO:0006996	0.735	organelle organization
GO:0065009	0.728	regulation of molecular function
GO:0080135	0.691	regulation of cellular response to stress
GO:0050790	0.672	regulation of catalytic activity
GO:0044092	0.634	negative regulation of molecular function
GO:0051336	0.630	regulation of hydrolase activity
GO:0045103	0.530	intermediate filament-based process
GO:0050896	0.518	response to stimulus
GO:0007010	0.498	cytoskeleton organization
GO:0043086	0.487	negative regulation of catalytic activity
GO:0052547	0.481	regulation of peptidase activity
GO:0051346	0.444	negative regulation of hydrolase activity
GO:0031323	0.430	regulation of cellular metabolic process
GO:0052548	0.426	regulation of endopeptidase activity
GO:0010466	0.399	negative regulation of peptidase activity
GO:0032502	0.374	developmental process
GO:0048856	0.352	anatomical structure development
GO:0010941	0.341	regulation of cell death
GO:0042981	0.319	regulation of apoptotic process
GO:0032501	0.318	multicellular organismal process
GO:0051129	0.314	negative regulation of cellular component organization
GO:0006950	0.302	response to stress
GO:0060548	0.302	negative regulation of cell death

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005829	0.997	cytosol
GO:0070013	0.988	intracellular organelle lumen
GO:0005654	0.980	nucleoplasm
GO:0043232	0.924	intracellular non-membrane-bounded organelle
GO:0016020	0.514	membrane
GO:0012505	0.313	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]